Recombinant Human Erbin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Erbin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1272-1371 of Human ERBB2IP partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS

Protein/Peptide Type
Partial Recombinant Protein
Gene
ERBB2IP

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Erbin Protein

  • Densin-180-like protein
  • erbb2 interacting protein
  • Erbb2-interacting proteinErbin
  • ERBB2IP
  • Erbin
  • ERBINLAP2protein LAP2
  • KIAA1225

Background

ERBB2IP - erbb2 interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NB120-2737
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56654
Species: Hu, Mu
Applications: WB, IHC-P
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-02211
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008502-M06
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Erbin Partial Recombinant Protein (H00055914-Q01) (0)

There are no publications for Erbin Partial Recombinant Protein (H00055914-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Erbin Partial Recombinant Protein (H00055914-Q01) (0)

There are no reviews for Erbin Partial Recombinant Protein (H00055914-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Erbin Partial Recombinant Protein (H00055914-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Erbin Products

Bioinformatics Tool for Erbin Partial Recombinant Protein (H00055914-Q01)

Discover related pathways, diseases and genes to Erbin Partial Recombinant Protein (H00055914-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Erbin Partial Recombinant Protein (H00055914-Q01)

Discover more about diseases related to Erbin Partial Recombinant Protein (H00055914-Q01).
 

Pathways for Erbin Partial Recombinant Protein (H00055914-Q01)

View related products by pathway.

PTMs for Erbin Partial Recombinant Protein (H00055914-Q01)

Learn more about PTMs related to Erbin Partial Recombinant Protein (H00055914-Q01).

Blogs on Erbin

There are no specific blogs for Erbin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Erbin Antibody
NBP2-13968

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Erbin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ERBB2IP
Entrez