CARS Antibody

Images

 
Western Blot: CARS Antibody [NBP1-86623] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431
Immunocytochemistry/ Immunofluorescence: CARS Antibody [NBP1-86623] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: CARS Antibody [NBP1-86623] - Staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CARS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CARS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CARS Protein (NBP1-86623PEP)
Publications
Read Publication using NBP1-86623.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CARS Antibody

  • CARS1
  • CysRS
  • cysteine translase
  • cysteine tRNA ligase 1, cytoplasmic
  • Cysteine--tRNA ligase
  • cysteinyl-tRNA synthetase
  • cysteinyl-tRNA synthetase, cytoplasmic
  • EC 6.1.1
  • EC 6.1.1.16
  • MGC:11246

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-19702
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
AF3749
Species: Hu
Applications: WB, IHC
NBP2-33807
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CARS Antibody (NBP1-86623)(1)

Reviews for CARS Antibody (NBP1-86623) (0)

There are no reviews for CARS Antibody (NBP1-86623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CARS Antibody (NBP1-86623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CARS Products

Bioinformatics Tool for CARS Antibody (NBP1-86623)

Discover related pathways, diseases and genes to CARS Antibody (NBP1-86623). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CARS Antibody (NBP1-86623)

Discover more about diseases related to CARS Antibody (NBP1-86623).
 

Pathways for CARS Antibody (NBP1-86623)

View related products by pathway.

PTMs for CARS Antibody (NBP1-86623)

Learn more about PTMs related to CARS Antibody (NBP1-86623).

Blogs on CARS

There are no specific blogs for CARS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CARS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CARS