CARS Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: CARS Antibody [NBP1-86623] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Independent Antibodies: Western Blot: CARS Antibody [NBP1-86623] - Analysis using Anti-CARS antibody NBP1-86623 (A) shows similar pattern to independent antibody NBP1-86624 (B).
Orthogonal Strategies: Immunohistochemistry-Paraffin: CARS Antibody [NBP1-86623] - Staining in human cerebral cortex and skeletal muscle tissues using anti-CARS antibody. Corresponding CARS RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: CARS Antibody [NBP1-86623] - Staining of human cerebral cortex, pancreas, skeletal muscle and testis using Anti-CARS antibody NBP1-86623 (A) shows similar ...read more
Immunohistochemistry-Paraffin: CARS Antibody [NBP1-86623] - Staining of human testis.
Immunohistochemistry-Paraffin: CARS Antibody [NBP1-86623] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: CARS Antibody [NBP1-86623] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: CARS Antibody [NBP1-86623] - Staining of human pancreas.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

CARS Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit CARS Antibody - BSA Free (NBP1-86623) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CARS Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CARS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CARS Protein (NBP1-86623PEP)
Publications
Read Publication using NBP1-86623.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CARS Antibody - BSA Free

  • CARS1
  • CysRS
  • cysteine translase
  • cysteine tRNA ligase 1, cytoplasmic
  • Cysteine--tRNA ligase
  • cysteinyl-tRNA synthetase
  • cysteinyl-tRNA synthetase, cytoplasmic
  • EC 6.1.1
  • EC 6.1.1.16
  • MGC:11246

Background

CARS encodes a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M6000B
Species: Mu
Applications: ELISA
664-LI
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
NBP1-92106
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00006301-M01
Species: Hu, Mu, Ze
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, KD, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-19702
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-13640
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-52511
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP2-13513
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF3749
Species: Hu
Applications: IHC, WB
NBP2-20262
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86623
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for CARS Antibody (NBP1-86623)(1)

Reviews for CARS Antibody (NBP1-86623) (0)

There are no reviews for CARS Antibody (NBP1-86623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CARS Antibody (NBP1-86623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CARS Products

Research Areas for CARS Antibody (NBP1-86623)

Find related products by research area.

Blogs on CARS

There are no specific blogs for CARS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CARS Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CARS1