Epithelial Stromal Interaction 1 Antibody

Images

 
Western Blot: Epithelial Stromal Interaction 1 Antibody [NBP1-89940] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human ...read more
Immunocytochemistry/ Immunofluorescence: Epithelial Stromal Interaction 1 Antibody [NBP1-89940] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: Epithelial Stromal Interaction 1 Antibody [NBP1-89940] - Staining of human bronchus shows cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Epithelial Stromal Interaction 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPSTI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Epithelial Stromal Interaction 1 Protein (NBP1-89940PEP)
Publications
Read Publication using
NBP1-89940 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24096480).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Epithelial Stromal Interaction 1 Antibody

  • BRESI1
  • EC 3.1.4.16
  • EC 3.6.3.6
  • epithelial stromal interaction 1 (breast)
  • epithelial-stromal interaction protein 1
  • MGC29634

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-58102
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-57838
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP2-24664
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-80653
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF6108
Species: Hu
Applications: IHC
H00004535-Q01
Species: Hu
NBP1-89345
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2045
Species: Hu
Applications: WB, IHC, ICC
NBP1-93504
Species: Hu
Applications: IHC, IHC-P

Publications for Epithelial Stromal Interaction 1 Antibody (NBP1-89940)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Epithelial Stromal Interaction 1 Antibody (NBP1-89940) (0)

There are no reviews for Epithelial Stromal Interaction 1 Antibody (NBP1-89940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Epithelial Stromal Interaction 1 Antibody (NBP1-89940) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Epithelial Stromal Interaction 1 Products

Bioinformatics Tool for Epithelial Stromal Interaction 1 Antibody (NBP1-89940)

Discover related pathways, diseases and genes to Epithelial Stromal Interaction 1 Antibody (NBP1-89940). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Epithelial Stromal Interaction 1 Antibody (NBP1-89940)

Discover more about diseases related to Epithelial Stromal Interaction 1 Antibody (NBP1-89940).
 

Pathways for Epithelial Stromal Interaction 1 Antibody (NBP1-89940)

View related products by pathway.

Blogs on Epithelial Stromal Interaction 1

There are no specific blogs for Epithelial Stromal Interaction 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Epithelial Stromal Interaction 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPSTI1