Epimorphin/Syntaxin 2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNTIDKITQYVEEVKK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
STX2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Epimorphin/Syntaxin 2 Antibody - BSA Free
Background
Syntaxin 2, also known as epimorphin, is a 35 kDa type II integral membrane that belongs to the t SNARE family, a group of proteins involved in protein transport. Syntaxin 2 was first identified as a factor that promotes branching morphogenesis in mammary epithelial cells. Studies using pancreatic exocrine acinar cells, in which the exocytic pathways are well defined, show primary localization of syntaxin 2 to the apical plasma membrane. Homologs of syntaxin 2 have been identified in various eukaryotes ranging from yeast to human. Neuronal syntaxin is a component of a 20S complex implicated in vesicle docking and fusion, which involves its interaction with syntaxin through a ATP dependent reaction modulated by synaptotagmin, SNAP 25, alpha SNAP, and NSF.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Mu
Applications: Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Publications for Epimorphin/Syntaxin 2 Antibody (NBP2-55283) (0)
There are no publications for Epimorphin/Syntaxin 2 Antibody (NBP2-55283).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Epimorphin/Syntaxin 2 Antibody (NBP2-55283) (0)
There are no reviews for Epimorphin/Syntaxin 2 Antibody (NBP2-55283).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Epimorphin/Syntaxin 2 Antibody (NBP2-55283) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Epimorphin/Syntaxin 2 Products
Research Areas for Epimorphin/Syntaxin 2 Antibody (NBP2-55283)
Find related products by research area.
|
Blogs on Epimorphin/Syntaxin 2