Epimorphin/Syntaxin 2 Antibody

Immunocytochemistry/Immunofluorescence: Epimorphin/Syntaxin 2 Antibody [NBP2-55283] - Staining of human cell line PC-3 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Epimorphin/Syntaxin 2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNTIDKITQYVEEVKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP)

Reactivity Notes

Mouse 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Epimorphin/Syntaxin 2 Antibody

• EPIMepimorphin
• Epimorphin
• EPM
• STX2
• STX2AMGC51014
• STX2Bsyntaxin-2
• STX2CEpimorphin
• Syntaxin 2

Background

Syntaxin 2, also known as epimorphin, is a 35 kDa type II integral membrane that belongs to the t SNARE family, a group of proteins involved in protein transport. Syntaxin 2 was first identified as a factor that promotes branching morphogenesis in mammary epithelial cells. Studies using pancreatic exocrine acinar cells, in which the exocytic pathways are well defined, show primary localization of syntaxin 2 to the apical plasma membrane. Homologs of syntaxin 2 have been identified in various eukaryotes ranging from yeast to human. Neuronal syntaxin is a component of a 20S complex implicated in vesicle docking and fusion, which involves its interaction with syntaxin through a ATP dependent reaction modulated by synaptotagmin, SNAP 25, alpha SNAP, and NSF.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STX2