Ephrin-A5 Antibody (1A2)

Images

 
Western Blot: Ephrin-A5 Antibody (1A2) [H00001946-M02] - Detection against Immunogen (35.64 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ephrin-A5 Antibody (1A2) Summary

Immunogen
EFNA5 (NP_001953 114 a.a. - 203 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EFNA5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ephrin-A5 Antibody (1A2)

  • AF1
  • AL-1
  • EFL-5
  • EFNA5
  • EPH-related receptor tyrosine kinase ligand 7
  • EphrinA5
  • Ephrin-A5
  • EPLG7
  • GLC1M
  • LERK-7
  • LERK7EFL5
  • RAGS

Background

Ephrin A5, a member of the ephrin family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF603
Species: Mu
Applications: WB, Block, ICC
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
359-EA
Species: Hu
MAB541
Species: Hu, Rt
Applications: WB, Flow, CyTOF-ready, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
640-A3
Species: Mu
AF641
Species: Mu
Applications: WB, IHC
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for Ephrin-A5 Antibody (H00001946-M02) (0)

There are no publications for Ephrin-A5 Antibody (H00001946-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ephrin-A5 Antibody (H00001946-M02) (0)

There are no reviews for Ephrin-A5 Antibody (H00001946-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ephrin-A5 Antibody (H00001946-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ephrin-A5 Products

Bioinformatics Tool for Ephrin-A5 Antibody (H00001946-M02)

Discover related pathways, diseases and genes to Ephrin-A5 Antibody (H00001946-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ephrin-A5 Antibody (H00001946-M02)

Discover more about diseases related to Ephrin-A5 Antibody (H00001946-M02).
 

Pathways for Ephrin-A5 Antibody (H00001946-M02)

View related products by pathway.

PTMs for Ephrin-A5 Antibody (H00001946-M02)

Learn more about PTMs related to Ephrin-A5 Antibody (H00001946-M02).
 

Research Areas for Ephrin-A5 Antibody (H00001946-M02)

Find related products by research area.

Blogs on Ephrin-A5

There are no specific blogs for Ephrin-A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ephrin-A5 Antibody (1A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol EFNA5
Entrez
Uniprot