EphA6 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EASIMGQFDHPNIIRLEGVVTKRSFPAIGVEAFCPSFLRAGFLNSIQAPH PVPGGGSLPPRIPAGRPVMIVVEYMENGSLDS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EPHA6 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for EphA6 Antibody
Background
The EPHA6 gene encodes an ephrin type-A receptor 6 (isoform 1: 1,035 amino acids long, 116 kDA: isoform 2: 334 amino acids long, 37 kDA) that functions to bind GPI-anchored ephrin-A family ligands. EPHA6 participates in EPhA forward signaling, axon guidance, cell adhesion ephrins signaling, g-protein signaling RhoA regulation pathway, and neurophysiological process receptor-mediated axon growth repulsion through interacts with genes EFNA1, EFNA2, EFNA3, EFNA5, and MLLT4. EPHA6 is linked to obesity, cerebritis, neuronitis, and schizophrenia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Rt
Applications: CyTOF-ready, Flow, ICC, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: Bind
Species: Hu
Applications: Bind
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: Bind
Species: Mu
Applications: WB
Species: Rt
Applications: Bind
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, WB
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Mu
Applications: WB
Species: Mu
Applications: Bind
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC-P
Publications for EphA6 Antibody (NBP2-13964) (0)
There are no publications for EphA6 Antibody (NBP2-13964).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EphA6 Antibody (NBP2-13964) (0)
There are no reviews for EphA6 Antibody (NBP2-13964).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EphA6 Antibody (NBP2-13964) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EphA6 Products
Research Areas for EphA6 Antibody (NBP2-13964)
Find related products by research area.
|
Blogs on EphA6