EphA6 Antibody

Images

 
Western Blot: EphA6 Antibody [NBP2-13964] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: EphA6 Antibody [NBP2-13964] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: EphA6 Antibody [NBP2-13964] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EphA6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EASIMGQFDHPNIIRLEGVVTKRSFPAIGVEAFCPSFLRAGFLNSIQAPH PVPGGGSLPPRIPAGRPVMIVVEYMENGSLDS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPHA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EphA6 Protein (NBP2-13964PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EphA6 Antibody

  • DKFZp434C1418
  • EC 2.7.10
  • EC 2.7.10.1
  • Ehk2
  • EHK-2
  • EPA6
  • EPH homology kinase 2
  • EPH receptor A6
  • EphA6
  • ephrin receptor EphA6
  • ephrin type-A receptor 6
  • FLJ35246
  • Hek12
  • PRO57066

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB541
Species: Hu, Rt
Applications: WB, Flow, CyTOF-ready, ICC
AF641
Species: Mu
Applications: WB, IHC
374-EA
Species: Hu
640-A3
Species: Mu
359-EA
Species: Hu
AF454
Species: Mu
Applications: WB
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF603
Species: Mu
Applications: WB, Block, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00002051-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-90297
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
NB100-1585
Species: Hu
Applications: WB (-), ICC/IF, IHC-P, IP, PLA
NBP2-58808
Species: Hu
Applications: WB, ICC/IF

Publications for EphA6 Antibody (NBP2-13964) (0)

There are no publications for EphA6 Antibody (NBP2-13964).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EphA6 Antibody (NBP2-13964) (0)

There are no reviews for EphA6 Antibody (NBP2-13964). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EphA6 Antibody (NBP2-13964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EphA6 Products

Bioinformatics Tool for EphA6 Antibody (NBP2-13964)

Discover related pathways, diseases and genes to EphA6 Antibody (NBP2-13964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EphA6 Antibody (NBP2-13964)

Discover more about diseases related to EphA6 Antibody (NBP2-13964).
 

Pathways for EphA6 Antibody (NBP2-13964)

View related products by pathway.

PTMs for EphA6 Antibody (NBP2-13964)

Learn more about PTMs related to EphA6 Antibody (NBP2-13964).
 

Research Areas for EphA6 Antibody (NBP2-13964)

Find related products by research area.

Blogs on EphA6

There are no specific blogs for EphA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EphA6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPHA6
Entrez