EphA5 Antibody

Images

 
Western Blot: EphA5 Antibody [NBP1-53105] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EphA5 Antibody Summary

Immunogen
Synthetic peptides corresponding to EPHA5(EPH receptor A5) The peptide sequence was selected from the middle region of EPHA5. Peptide sequence SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPHA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against EPHA5 and was validated on Western blot.
Theoretical MW
114 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EphA5 Antibody

  • Bsk
  • Cek7
  • EC 2.7.10
  • EC 2.7.10.1
  • Ehk1
  • EHK-1
  • EHK1Hek7
  • EK7
  • EPH homology kinase 1
  • Eph homology kinase-1
  • EPH receptor A5
  • EphA5
  • EPH-like kinase 7
  • ephrin type-A receptor 5
  • Hek7
  • receptor protein-tyrosine kinase HEK7
  • Rek7
  • TYRO4HEK7CEK7
  • tyrosine-protein kinase receptor EHK-1

Background

EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

374-EA
Species: Hu
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF603
Species: Mu
Applications: WB, Block, ICC
AF641
Species: Mu
Applications: WB, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
359-EA
Species: Hu
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-47761
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00002051-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-13964
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
7570-GH
Species: Hu
AF454
Species: Mu
Applications: WB
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for EphA5 Antibody (NBP1-53105) (0)

There are no publications for EphA5 Antibody (NBP1-53105).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EphA5 Antibody (NBP1-53105) (0)

There are no reviews for EphA5 Antibody (NBP1-53105). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EphA5 Antibody (NBP1-53105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EphA5 Products

Bioinformatics Tool for EphA5 Antibody (NBP1-53105)

Discover related pathways, diseases and genes to EphA5 Antibody (NBP1-53105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EphA5 Antibody (NBP1-53105)

Discover more about diseases related to EphA5 Antibody (NBP1-53105).
 

Pathways for EphA5 Antibody (NBP1-53105)

View related products by pathway.

PTMs for EphA5 Antibody (NBP1-53105)

Learn more about PTMs related to EphA5 Antibody (NBP1-53105).
 

Research Areas for EphA5 Antibody (NBP1-53105)

Find related products by research area.

Blogs on EphA5

There are no specific blogs for EphA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EphA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPHA5
Entrez
Uniprot