EPB41L3 Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human EPB41L3. Peptide sequence: MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAA The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
EPB41L3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for EPB41L3 Antibody - BSA Free
Background
Band 4.1-like protein 3 (EPB41L3) is a critical growth regulator in the pathogenesis of meningiomas. EPB41L3 is highly Expressed in the brain, with lower levels found in the kidneys, intestines, and testis.
EPB41L3 is a member of a family of similar proteins whose expression is frequently lost in a variety of human tumors, including meningiomas, non-small-cell lung cancers, and breast carcinomas. It is also frequently down-regulated in human clinical prostate cancer. Studies have shown that Protein 4.1B normally triggers death in metastatic cells, thereby preventing cancer from spreading. A clinical test for Protein 4.1B activity could be useful in assessing the metastatic potential of prostate cancers. Therefore, EPB41L3 antibodies may be very useful for cancer research.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Rt
Applications: ICC/IF, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: WB
Publications for EPB41L3 Antibody (NBP2-84859) (0)
There are no publications for EPB41L3 Antibody (NBP2-84859).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EPB41L3 Antibody (NBP2-84859) (0)
There are no reviews for EPB41L3 Antibody (NBP2-84859).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EPB41L3 Antibody (NBP2-84859) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EPB41L3 Products
Research Areas for EPB41L3 Antibody (NBP2-84859)
Find related products by research area.
|
Blogs on EPB41L3