EPB41L3 Antibody - BSA Free

Analysis in human testis and skeletal muscle tissues using NBP1-89372 antibody. Corresponding EPB41L3 RNA-seq data are presented for the same tissues.

Staining of human testis shows moderate cytoplasmic and membranous positivity in cells in seminiferous ducts.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: EPB41L3 Antibody [NBP1-89372] - Staining of human gastrointestinal shows moderate to strong cytoplasmic and membranous positivity in glandular cells.

Staining of human kidney shows moderate to strong membranous positivity in cells in tubules.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

ICC/IF: EPB41L3 Antibody [NBP1-89372] - Staining of human cell line U-2 OS shows localization to plasma membrane.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EPB41L3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EPB41L3 Antibody - BSA Free (NBP1-89372) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEGAKEEGGEEVAKAVLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPB41L3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EPB41L3 Protein (NBP1-89372PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EPB41L3 Antibody - BSA Free

• 4.1BFLJ37633
• DAL1DAL-1,
• Differentially expressed in adenocarcinoma of the lung protein 1
• erythrocyte membrane protein band 4.1-like 3
• KIAA0987band 4.1-like protein 3

Background

Band 4.1-like protein 3 (EPB41L3) is a critical growth regulator in the pathogenesis of meningiomas. EPB41L3 is highly Expressed in the brain, with lower levels found in the kidneys, intestines, and testis.

EPB41L3 is a member of a family of similar proteins whose expression is frequently lost in a variety of human tumors, including meningiomas, non-small-cell lung cancers, and breast carcinomas. It is also frequently down-regulated in human clinical prostate cancer. Studies have shown that Protein 4.1B normally triggers death in metastatic cells, thereby preventing cancer from spreading. A clinical test for Protein 4.1B activity could be useful in assessing the metastatic potential of prostate cancers. Therefore, EPB41L3 antibodies may be very useful for cancer research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPB41L3