Enteropeptidase/Enterokinase Antibody (3F8)

Images

 
Sandwich ELISA: Enteropeptidase/Enterokinase Antibody (3F8) [H00005651-M01] - Detection limit for recombinant GST tagged PRSS7 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Enteropeptidase/Enterokinase Antibody (3F8) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PRSS7 (NP_002763, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLN
Specificity
PRSS7 - protease, serine, 7 (enterokinase)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TMPRSS15
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Enteropeptidase/Enterokinase Antibody (3F8)

  • EC 3.4.21
  • EC 3.4.21.9
  • Enterokinase
  • Enteropeptidase
  • ENTK
  • ENTKenterokinase
  • MGC133046
  • protease, serine, 7 (enterokinase)
  • PRSS7
  • PRSS7enteropeptidase
  • Serine protease 7
  • TMPRSS15
  • Transmembrane protease serine 15
  • transmembrane protease, serine 15

Background

This gene encodes an enzyme that converts the pancreatic proenzyme trypsinogen to trypsin, which activates other proenzymes including chymotrypsinogen and procarboxypeptidases. The precursor protein is cleaved into two chains that form a heterodimer linked by a disulfide bond. This protein is a member of the trypsin family of peptidases. Mutations in this gene cause enterokinase deficiency, a malabsorption disorder characterized by diarrhea and failure to thrive.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Enteropeptidase/Enterokinase Antibody (H00005651-M01) (0)

There are no publications for Enteropeptidase/Enterokinase Antibody (H00005651-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Enteropeptidase/Enterokinase Antibody (H00005651-M01) (0)

There are no reviews for Enteropeptidase/Enterokinase Antibody (H00005651-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Enteropeptidase/Enterokinase Antibody (H00005651-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Enteropeptidase/Enterokinase Products

Research Areas for Enteropeptidase/Enterokinase Antibody (H00005651-M01)

Find related products by research area.

Blogs on Enteropeptidase/Enterokinase

There are no specific blogs for Enteropeptidase/Enterokinase, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Enteropeptidase/Enterokinase Antibody (3F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPRSS15
Entrez
Uniprot