Enolase 2/Neuron-specific Enolase Antibody (1A3)

Images

 
Western Blot: Enolase 2/Neuron-specific Enolase Antibody (1A3) [H00002026-M01] - Analysis of ENO2 expression in transfected 293T cell line by ENO2 monoclonal antibody (M01), clone 1A3.Lane 1: ENO2 transfected ...read more
Western Blot: Enolase 2/Neuron-specific Enolase Antibody (1A3) [H00002026-M01] - ENO2 monoclonal antibody (M01), clone 1A3. Analysis of ENO2 expression in different cell lines.
ELISA: Enolase 2/Neuron-specific Enolase Antibody (1A3) [H00002026-M01] - Detection limit for recombinant GST tagged ENO2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Enolase 2/Neuron-specific Enolase Antibody (1A3) Summary

Immunogen
ENO2 (AAH02745, 325 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL
Localization
Cytoplasmic.
Marker
Neuronal Marker
Specificity
ENO2 - enolase 2 (gamma, neuronal)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ENO2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00002026-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Enolase 2/Neuron-specific Enolase Antibody (1A3)

  • 2-phospho-D-glycerate hydrolyase
  • 2-phospho-D-glycerate hydro-lyase
  • EC 4.2.1.11
  • ENO2
  • enolase 2 (gamma, neuronal)
  • Enolase 2
  • gamma-Enolase
  • Neural enolase
  • neuron specific gamma enolase
  • neurone-specific enolase
  • Neuronspecific Enolase
  • Neuron-specific enolase
  • NSE

Background

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45267
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: IHC, WB
H00005670-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF3844
Species: Hu, Mu
Applications: IHC
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP3-03282
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46349
Species: Hu
Applications: IHC, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
H00002026-M01
Species: Hu
Applications: WB, ELISA

Publications for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)(1)

Reviews for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01) (0)

There are no reviews for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Enolase 2/Neuron-specific Enolase Products

Bioinformatics Tool for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)

Discover related pathways, diseases and genes to Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)

Discover more about diseases related to Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01).
 

Pathways for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)

View related products by pathway.

PTMs for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)

Learn more about PTMs related to Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01).
 

Research Areas for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)

Find related products by research area.

Blogs on Enolase 2/Neuron-specific Enolase

There are no specific blogs for Enolase 2/Neuron-specific Enolase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Enolase 2/Neuron-specific Enolase Antibody (1A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ENO2
Entrez
OMIM
Uniprot