Home » Enolase 2/Neuron-specific Enolase » Enolase 2/Neuron-specific Enolase Antibodies » Enolase 2/Neuron-specific Enolase Antibody (1A3)

Enolase 2/Neuron-specific Enolase Antibody (1A3)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Enolase 2/Neuron-specific Enolase Antibody (1A3) [H00002026-M01] - Analysis of ENO2 expression in transfected 293T cell line by ENO2 monoclonal antibody (M01), clone 1A3.Lane 1: ENO2 transfected lysate(47.3 KDa).Lane 2: Non-transfected lysate.
Western Blot: Enolase 2/Neuron-specific Enolase Antibody (1A3) [H00002026-M01] - Analysis of ENO2 expression in transfected 293T cell line by ENO2 monoclonal antibody (M01), clone 1A3.Lane 1: ENO2 transfected ...read more
Western Blot: Enolase 2/Neuron-specific Enolase Antibody (1A3) [H00002026-M01] - ENO2 monoclonal antibody (M01), clone 1A3. Analysis of ENO2 expression in different cell lines.
ELISA: Enolase 2/Neuron-specific Enolase Antibody (1A3) [H00002026-M01] - Detection limit for recombinant GST tagged ENO2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Enolase 2/Neuron-specific Enolase Antibody (1A3) Summary

Immunogen
ENO2 (AAH02745, 325 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL
Localization
Cytoplasmic.
Marker
Neuronal Marker
Specificity
ENO2 - enolase 2 (gamma, neuronal)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ENO2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00002026-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Enolase 2/Neuron-specific Enolase Antibody (1A3)

  • 2-phospho-D-glycerate hydrolyase
  • 2-phospho-D-glycerate hydro-lyase
  • EC 4.2.1.11
  • ENO2
  • enolase 2 (gamma, neuronal)
  • Enolase 2
  • gamma-Enolase
  • Neural enolase
  • neuron specific gamma enolase
  • neurone-specific enolase
  • Neuronspecific Enolase
  • Neuron-specific enolase
  • NSE

Background

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Enolase 1 Antibody
(8G8)
H00002023-M01
Western Blot: Enolase 1 Antibody (8G8) [H00002023-M01] - Analysis of ENO1 expression in transfected 293T cell line by ENO1 monoclonal antibody (M01), clone 8G8.Lane 1: ENO1 transfected lysate(47 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: Enolase 1 Antibody (8G8) [H00002023-M01] - Analysis of monoclonal antibody to ENO1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Enolase 1 Antibody (8G8) [H00002023-M01] - Analysis of monoclonal antibody to ENO1 on formalin-fixed paraffin-embedded human lymphoma tissue. Antibody concentration 1 ug/ml.
(9 Publications)
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
GFAP Antibody
NB300-141
Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
Western Blot: GFAP Antibody [NB300-141] - Analysis of different tissue lysates using rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord. Strong band at about 50 kDa corresponds to the major isotype of the GFAP protein. Smaller isotypes and proteolytic fragments of GFAP are also detected on the blot.
Western Blot: GFAP Antibody [NB300-141] - Analysis of Rat brain lysate. Antibody at 1:5000. Specific band running with an apparent SDS-PAGE molecular weight of ~50 kDa corresponds to rodent GFAP was observed.
(12 Reviews)
(82 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Synaptophysin
Antibody
NB300-653
Immunohistochemistry-Frozen: Synaptophysin Antibody [NB300-653] - Feline retina. Synaptophysin (green), DAPI (blue). The image was capture by epifluorescent microscopy. Image from verified customer review.
Western Blot: Synaptophysin Antibody [NB300-653] - Approximate MW of Synaptophysin is 39kDa.
Immunohistochemistry-Paraffin: Synaptophysin Antibody [NB300-653] - Rat brain, 1:100 dilution.
(2 Reviews)
(7 Publications)
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(6 Reviews)
(55 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Chromogranin A
Antibody - BSA Free
NB120-15160
Immunocytochemistry/Immunofluorescence: Chromogranin A Antibody [NB120-15160] - Mouse pancreas cryosections stained with insulin (DAKO, Green) and Chromogranin A (NB120-15160; 1:500; White)
Immunocytochemistry/Immunofluorescence: Chromogranin A Antibody [NB120-15160] - Neuro2a cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Chromogranin A Antibody at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: Chromogranin A Antibody [NB120-15160] - The frequency of chromogranin A positive hormone-negative (CPHN) cells decreases with age. Representative pancreatic sections from fetal (A) and infant-child (B-D) cases immunostained for Endocrine cocktail (insulin, glucagon, somatostatin, pancreatic polypeptide, and ghrelin) (white), chromogranin A (green), and DAPI (blue). Yellow arrows show CPHN cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (https://www.frontiersin.org/article/10.3389/fendo.2018.00791/full), licensed under a CC-BY licence.
(2 Reviews)
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
S100B Antibody
(15F9NB) - BSA Free
NBP2-45267
Flow Cytometry: S100B Antibody (15F9NB) [NBP2-45267] - An intracellular stain was performed on SK-MEL-28 cells with S100B [15F9NB] Antibody NBP2-45267PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Flow Cytometry: S100B Antibody (15F9NB) [NBP2-45267] - Staining of A431 cells (1 x 10^6 cells/ml) with S100B antibody, clone 15F4.1D2 (Orange) stained at a dilution of 1:500. Detected with a GtxRb DyLight 488 secondary. Shown with the secondary control (Blue).
Immunocytochemistry/Immunofluorescence: S100B Antibody (15F9NB) [NBP2-45267] - Analysis in A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with S100B (15F4NB) at a 1:100 dilution overnight at 4 degrees Celsius and detected with DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were detected with DAPI (Blue) at 2.0 ug/ml in 1X PBS. Cells were imaged using a 40X objective.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CEACAM5/CD66e
Antibody (CEA31) - Az ...
NBP2-34594
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human Colon Carcinoma stained with CEACAM5/CD66e Antibody (CEA31).
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human Colon Carcinoma stained with CEACAM5/CD66e Antibody (CEA31).
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human Colon Carcinoma stained with CEACAM5/CD66e Antibody (CEA31).
(2 Reviews)
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
CEACAM7 Antibody
[Unconjugated]
AF4478
CEACAM‑7 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cell surfaces of cancer cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of LNCaP human prostate cancer cell line, HeLa human cervical epithelial carcinoma cell line and human liver tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CEACAM‑7 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: IHC, WB
Recombinant Human
PSG2 GST (N-Term) Pro ...
H00005670-Q01
SDS-Page: Recombinant Human PSG2 Protein [H00005670-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Desmin Antibody
AF3844
Desmin was detected in immersion fixed frozen sections of mouse skeletal muscle using Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to z-lines. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Desmin was detected in immersion fixed paraffin-embedded sections of human heart using 15 µg/mL Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the sarcoplasm of cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(16 Publications)
Species: Hu, Mu
Applications: IHC
GM-CSF
[Unconjugated]
7954-GM/CF
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 6-30 pg/mL.
(2 Publications)
Species: Hu
Applications: BA
LAMC2 Antibody
(CL2980)
NBP2-42388
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in human cell line A-431.
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LAMC2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining of human skin shows moderate positivity in basement membrane of epidermis.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Procalcitonin
Antibody (44D9)
NB120-14817
Procalcitonin Antibody (44D9)
(1 Review)
(8 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
S100A1 Antibody
NBP1-87103
Western Blot: S100A1 Antibody [NBP1-87103] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: S100A1 Antibody [NBP1-87103] - Staining of human heart muscle shows moderate to strong nuclear positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: S100A1 Antibody [NBP1-87103] - Staining in human heart muscle and lymph node tissues.. Corresponding S100A1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MUC1 Antibody
(SM3) - BSA Free
NB120-22711
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MCF7 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MUC1 [SM3] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: MUC1 Antibody (SM3) - BSA Free [NB120-22711] - An intracellular stain was performed on MCF7 cells with MUC1 Antibody (SM3) NB120-22711AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MUC-1 antibody was tested in MCF7 cells at 10 ug/ml using a Dylight 488 conjugated secondary antibody (Green). Actin (Red) and DNA (Blue) were counterstained using Phalloidin 568 and DAPI.
(11 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence: Somatostatin Antibody (7G5) [NBP2-37447] - Paraffin-embedded human adult pancreas tissue. pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis of lung cancer tissues using SST mouse mAb with DAB staining.
ELISA: Somatostatin Antibody (7G5) [NBP2-37447] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
(1 Review)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
Gastrin-releasing
Peptide/Bombesin/Neur ...
NBP3-03282
Immunocytochemistry/Immunofluorescence: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Immunofluorescence analysis of HeLa cells using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody (NBP3-03282) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Rat brain using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb (NBP3-03282) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Mouse heart using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb (NBP3-03282) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
VIP Antibody
(OTI1E8)
NBP2-46349
Immunohistochemistry: VIP Antibody (1E8) [NBP2-46349] - Analysis of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: VIP Antibody (1E8) [NBP2-46349] - Analysis of Human Kidney tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: VIP Antibody (1E8) [NBP2-46349] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu
Applications: IHC, WB
MBP Antibody (12)
NB600-717
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse spinal cord ventral white matter. Image from verified customer review.
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse brain corpus callosum. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: MBP Antibody (12) [NB600-717] - Histological and mRNA analysis of the inflammatory cytokines in the vehicle- or etifoxine-treated mice at onset of clinical symptoms. At day 10 p.i., drug treated animals showed significant differences in MBP staining. Animals treated with etifoxine showed an increase in retention of percentage of MBP coverage (*p = 0.001). Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/cgi/doi/10.1002/emmm.201202124), licensed under a CC-BY licence.
(3 Reviews)
(27 Publications)
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Enolase
2/Neuron-specific Eno ...
H00002026-M01
Enolase 2/Neuron-specific Enolase Antibody (1A3)
Species: Hu
Applications: WB, ELISA

Publications for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)(1)


Reviews for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01) (0)

There are no reviews for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Enolase 2/Neuron-specific Enolase Products

Bioinformatics Tool for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)

Discover related pathways, diseases and genes to Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)

Discover more about diseases related to Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01).
 

Pathways for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)

View related products by pathway.

PTMs for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)

Learn more about PTMs related to Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01).
 

Research Areas for Enolase 2/Neuron-specific Enolase Antibody (H00002026-M01)

Find related products by research area.

Blogs on Enolase 2/Neuron-specific Enolase

There are no specific blogs for Enolase 2/Neuron-specific Enolase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Enolase 2/Neuron-specific Enolase Antibody (1A3) and receive a gift card or discount.


Bioinformatics

Gene Symbol ENO2
Entrez
OMIM
Uniprot