ENO3 Antibody (5D1) - Azide and BSA Free

Images

 
Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody (M01), clone 5D1.Lane 1: ENO3 transfected lysate(46.9 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi ( Cat # H00002027-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - ENO3 monoclonal antibody (M01), clone 5D1 Analysis of ENO3 expression in HeLa.
Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.5 ug/ml.
ELISA: ENO3 Antibody (5D1) [H00002027-M01] - Detection limit for recombinant GST tagged ENO3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Rt, BvSpecies Glossary
Applications WB, DB, ELISA, ICC/IF, IHC, IP, Mycoplasma
Clone
5D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

ENO3 Antibody (5D1) - Azide and BSA Free Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Specificity
ENO3 - enolase 3 (beta, muscle)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ENO3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Dot Blot
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. Use in Dot blot reported in scientific literature (PMID:26344128).
Publications
Read Publications using
H00002027-M01 in the following applications:

Reactivity Notes

Bovine reactivity reported in multiple pieces of scientific literature.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ENO3 Antibody (5D1) - Azide and BSA Free

  • 2-phospho-D-glycerate hydrolyase
  • 2-phospho-D-glycerate hydro-lyase
  • beta-enolase
  • EC 4.2.1
  • EC 4.2.1.11
  • enolase 3 (beta, muscle)
  • Enolase 3
  • enolase 3, (beta, muscle)
  • GSD13
  • MSE
  • Muscle-specific enolase
  • Skeletal muscle enolase

Background

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC,  IHC-P, IP, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
NBP2-67503
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85630
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DC140
Species: Hu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-31225
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31661
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF2185
Species: Hu, Mu, Rt
Applications: IP, WB
MAB66861
Species: Hu
Applications: ICC, WB
4308-SE
Species: Hu
Applications: EnzAct

Publications for ENO3 Antibody (H00002027-M01)(14)

We have publications tested in 1 confirmed species: Bovine.

We have publications tested in 2 applications: Cytometric Bead Assay Standard, WB.


Filter By Application
Cytometric Bead Assay Standard
(1)
WB
(2)
All Applications
Filter By Species
Bovine
(1)
All Species
Showing Publications 1 - 10 of 14. Show All 14 Publications.
Publications using H00002027-M01 Applications Species
Huppertz I, Perez-Perri JI, Mantas P et al. Riboregulation of Enolase 1 activity controls glycolysis and embryonic stem cell differentiation Molecular cell 2022-06-10 [PMID: 35709751] (WB) WB
Picard B, Gagaoua M, Al Jammas M, Bonnet M et al. Beef tenderness and intramuscular fat proteomic biomarkers: Effect of gender and rearing practices. J Proteomics. 2019-03-17 [PMID: 30894324]
Gagaoua M, Bonnet M, De Koning L et al. Reverse Phase Protein array for the quantification and validation of protein biomarkers of beef qualities: The case of meat color from Charolais breed. Meat Sci 2018-07-05 [PMID: 30015160]
Picard B, Gagaoua M, Al-Jammas M et al. Beef tenderness and intramuscular fat proteomic biomarkers: muscle type effect. PeerJ 2018-06-07 [PMID: 29892502]
Gagaoua M, Bonnet M, Ellies-Oury MP et al. Reverse phase protein arrays for the identification/validation of biomarkers of beef texture and their use for early classification of carcasses. Food Chem 2018-01-10 [PMID: 29412918]
Yu Q, Wu W, Tian X et al. Unraveling proteome changes of Holstein beef M. semitendinosus and its relationship to meat discoloration during post-mortem storage analyzed by label-free mass spectrometry. J Proteomics 2016-12-28 [PMID: 28039026]
Brocca L, Longa E, Cannavino J et al. Human skeletal muscle fibre contractile properties and proteomic profile: Adaptations to 3-week unilateral lower limb suspension and active recovery. J Physiol. 2015-09-15 [PMID: 26369674]
Gagaoua M, Terlouw EMC, Boudjellal A, Picard B. Coherent correlation networks among protein biomarkers of beef tenderness: What they reveal. Journal of proteomics 2015-10-14 [PMID: 26344128] (WB, Cytometric Bead Assay Standard, Bovine) WB, Cytometric Bead Assay Standard Bovine
Picard B, Gagaoua M, Micol D et al. Inverse relationships between biomarkers and beef tenderness according to contractile and metabolic properties of the muscle. J Agric Food Chem 2014-08-24 [PMID: 25175407]
Brocca L, Cannavino J, Coletto L et al. The time course of the adaptations of human muscle proteome to bed rest and the underlying mechanisms. J Physiol. 2012-07-30 [PMID: 22848045]
Show All 14 Publications.

Reviews for ENO3 Antibody (H00002027-M01) (0)

There are no reviews for ENO3 Antibody (H00002027-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ENO3 Antibody (H00002027-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ENO3 Antibody (5D1) - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ENO3
Entrez
OMIM
Uniprot