enkurin Antibody - BSA Free

Immunohistochemistry-Paraffin: enkurin Antibody [NBP1-89911] - Staining in human fallopian tube and colon tissues using anti-ENKUR antibody. Corresponding ENKUR RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: enkurin Antibody [NBP1-89911] - Staining of human bronchus, colon, fallopian tube and kidney using Anti-ENKUR antibody NBP1-89911 (A) shows similar protein distribution across tissues to independent antibody NBP2-34037 (B).

Western Blot: enkurin Antibody [NBP1-89911] - Analysis in control (vector only transfected HEK293T lysate) and ENKUR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: enkurin Antibody [NBP1-89911] - Staining of human bronchus.

Immunohistochemistry-Paraffin: enkurin Antibody [NBP1-89911] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: enkurin Antibody [NBP1-89911] - Staining of human kidney.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

enkurin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEE
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ENKUR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  enkurin Protein (NBP1-89911PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for enkurin Antibody - BSA Free

• C10orf63DKFZp781F21103
• chromosome 10 open reading frame 63
• enkurin
• enkurin, TRPC channel interacting protein
• MGC26778

Background

Enkurin interacts with transient receptor potential canonical (TRPC) cation channels (see TRPC1; MIM 602343) and functions as an adapter protein, tethering signal transduction proteins to TRPC channels (Sutton et al., 2004 [PubMed 15385169]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ENKUR