enkurin Antibody

Images

 
Western Blot: enkurin Antibody [NBP1-89911] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: enkurin Antibody [NBP1-89911] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes in granular pattern.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

enkurin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENKUR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
enkurin Protein (NBP1-89911PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for enkurin Antibody

  • C10orf63DKFZp781F21103
  • chromosome 10 open reading frame 63
  • enkurin
  • enkurin, TRPC channel interacting protein
  • MGC26778

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12919
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-70352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF2364
Species: Hu
Applications: WB, IHC
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22212
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
H00009139-M15
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-98846
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
MAB6777
Species: Hu
Applications: WB, ICC
AF3320
Species: Hu
Applications: WB, IHC
NBP2-12905
Species: Rt
Applications: WB, ICC/IF, IHC, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14428
Species: Hu
Applications: IHC, IHC-P
NBP1-89911
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for enkurin Antibody (NBP1-89911) (0)

There are no publications for enkurin Antibody (NBP1-89911).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for enkurin Antibody (NBP1-89911) (0)

There are no reviews for enkurin Antibody (NBP1-89911). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for enkurin Antibody (NBP1-89911) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional enkurin Products

Bioinformatics Tool for enkurin Antibody (NBP1-89911)

Discover related pathways, diseases and genes to enkurin Antibody (NBP1-89911). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on enkurin

There are no specific blogs for enkurin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our enkurin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENKUR