Endophilin A1/SH3GL2 Antibody

Images

 
Western Blot: Endophilin A1/SH3GL2 Antibody [NBP1-85521] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-525
Orthogonal Strategies: Immunohistochemistry-Paraffin: Endophilin A1/SH3GL2 Antibody [NBP1-85521] - Staining in human cerebral cortex and pancreas tissues using anti-SH3GL2 antibody. Corresponding SH3GL2 RNA-seq ...read more
Immunohistochemistry-Paraffin: Endophilin A1/SH3GL2 Antibody [NBP1-85521] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Endophilin A1/SH3GL2 Antibody [NBP1-85521] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Endophilin A1/SH3GL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELG
Specificity
Specificity of human Endophilin A1/SH3GL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3GL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Endophilin A1/SH3GL2 Protein (NBP1-85521PEP)
Publications
Read Publication using NBP1-85521.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Endophilin A1/SH3GL2 Antibody

  • CNSA2
  • CNSA2FLJ25015
  • EEN-B1
  • EEN-B1bA335L15.1 (SH3-domain GRB2-like 2)
  • Endophilin A1
  • Endophilin-1
  • endophilin-A1
  • FLJ20276
  • SH3 domain protein 2A
  • SH3 domain-containing GRB2-like protein 2
  • SH3D2A
  • SH3D2AEndophilin A1 BAR domain
  • SH3-domain GRB2-like 2
  • SH3GL2
  • SH3P4
  • SH3P4endophilin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-02834
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87561
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84419
Species: Hu
Applications: WB, IHC, IHC-P
H00001813-M01A
Species: Hu
Applications: WB, ELISA
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-86588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-64644
Species: Hu

Publications for Endophilin A1/SH3GL2 Antibody (NBP1-85521)(1)


Reviews for Endophilin A1/SH3GL2 Antibody (NBP1-85521) (0)

There are no reviews for Endophilin A1/SH3GL2 Antibody (NBP1-85521). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Endophilin A1/SH3GL2 Antibody (NBP1-85521) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Endophilin A1/SH3GL2 Products

Bioinformatics Tool for Endophilin A1/SH3GL2 Antibody (NBP1-85521)

Discover related pathways, diseases and genes to Endophilin A1/SH3GL2 Antibody (NBP1-85521). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endophilin A1/SH3GL2 Antibody (NBP1-85521)

Discover more about diseases related to Endophilin A1/SH3GL2 Antibody (NBP1-85521).
 

Pathways for Endophilin A1/SH3GL2 Antibody (NBP1-85521)

View related products by pathway.

PTMs for Endophilin A1/SH3GL2 Antibody (NBP1-85521)

Learn more about PTMs related to Endophilin A1/SH3GL2 Antibody (NBP1-85521).

Blogs on Endophilin A1/SH3GL2

There are no specific blogs for Endophilin A1/SH3GL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Endophilin A1/SH3GL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GL2
Entrez