EMP3 Antibody (2C4)


Sandwich ELISA: EMP3 Antibody (2C4) [H00002014-M03] - Detection limit for recombinant GST tagged EMP3 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

EMP3 Antibody (2C4) Summary

EMP3 (NP_001416.1, 25 a.a. - 68 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQV
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EMP3 Antibody (2C4)

  • EMP3
  • EMP-3
  • epithelial membrane protein 3
  • HNMP-1
  • Protein YMP
  • YMP
  • YMPHematopoietic neural membrane protein 1


EMP3 is an integral membrane protein that may be involved in cell proliferation and cell-cell interactions.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD

Publications for EMP3 Antibody (H00002014-M03) (0)

There are no publications for EMP3 Antibody (H00002014-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMP3 Antibody (H00002014-M03) (0)

There are no reviews for EMP3 Antibody (H00002014-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMP3 Antibody (H00002014-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for EMP3 Antibody (H00002014-M03)

Discover related pathways, diseases and genes to EMP3 Antibody (H00002014-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMP3 Antibody (H00002014-M03)

Discover more about diseases related to EMP3 Antibody (H00002014-M03).

Pathways for EMP3 Antibody (H00002014-M03)

View related products by pathway.

PTMs for EMP3 Antibody (H00002014-M03)

Learn more about PTMs related to EMP3 Antibody (H00002014-M03).

Research Areas for EMP3 Antibody (H00002014-M03)

Find related products by research area.

Blogs on EMP3

There are no specific blogs for EMP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EMP3 Antibody (2C4) and receive a gift card or discount.


Gene Symbol EMP3