Recombinant Human EMP2 Protein

Images

 
Western Blot: EMP2 Recombinant Protein [H00002013-P01] - analysis of EMP2 using anti-EMP2 antibody (Cat.# NBP1-86847). The EMP2 recombinant protein was used as a positive control. Image from verified customer review.
ELISA: EMP2 Recombinant Protein [H00002013-P01] - EMP2 recombinant protein coated into ELISA plate; used as a positive control for EMP2 antibody (Cat# NBP1-86847). Image from verified customer review.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EMP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-167 of Human EMP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK

Protein/Peptide Type
Recombinant Protein
Gene
EMP2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Reviewed Applications
Read 2 Reviews rated 5
using
H00002013-P01 in the following application:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EMP2 Protein

  • EMP2
  • epithelial membrane protein 2
  • MGC9056
  • Protein XMP
  • XMP
  • XMPEMP-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008833-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBL1-10259
Species: Hu
MAB4505
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-59438
Species: Hu
Applications: WB, ELISA, IHC
H00007348-M05
Species: Hu
Applications: WB, ELISA
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15012
Species: Hu
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF7288
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for EMP2 Recombinant Protein (H00002013-P01) (0)

There are no publications for EMP2 Recombinant Protein (H00002013-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMP2 Recombinant Protein (H00002013-P01) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Other.
We have 2 reviews tested in 2 application: ELISA, WB.

Reviews using H00002013-P01:
Filter by Applications
ELISA
(1)
WB
(1)
All Applications
Filter by Species
Human
(1)
Other
(1)
All Species
Images Ratings Applications Species Date Details
ELISA EMP2 H00002013-P01
Enlarge
reviewed by:
Anonymous
ELISA Human 10/02/2015
View

Summary

ApplicationELISA
Sample TestedEMP2 Recombinant Protein (H00002013-P01)
SpeciesHuman
LotF2251

Blocking

Blocking Details2% BSA in PBS 1 hour at room temperature

Primary Anitbody

Dilution Ratio1:2000 in 2% BSA-PBS overnight at 4C

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#Cell Signaling, #7074
Secondary Concentration1:5000

Details

Detection NotesRD Systems Cat# DY999 Substrate Reagent, for each well, add 50ul A+ 50ul B, 2 min later add Stop solution 50uL, read under 450nM
ELISA Plate Details96-well plate is poly-D-lysine (Greiner bio-one cat#655946), 0.1ug/well coated in PBS overnight at 4C
Wash Description0.05% Tween20 in PBS washing buffer for 3 times

Comments

CommentsThis EMP2 Recombinant Protein (H00002013-P01) worked very well in my ELISA experiment as positive control.
Western Blot EMP2 H00002013-P01
Enlarge
reviewed by:
Anonymous
WB Other 03/13/2015
View

Summary

ApplicationWestern Blot
Sample TestedEMP2 (NP_001415.1, 1 a.a. - 167 a.a.) recombinant protein with a ~26kD N-terminal GST tag.
SpeciesOther
LotF2251

Blocking

Blocking Details2% cold fish geletin in TBS buffer, room temperature for 1hour

Primary Anitbody

Dilution RatioEMP2 antibody Novus NBP1-86847, Rabbit 1:500

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#Cell Signaling, #7074
Secondary Concentration1:5000

Details

Detection Notes15-second exposure shows strong band at correct MW.

Comments

Commentsthis recombinant protein of EMP2 works very well as positive control in western blot.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMP2 Recombinant Protein (H00002013-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EMP2 Products

Bioinformatics Tool for EMP2 Recombinant Protein (H00002013-P01)

Discover related pathways, diseases and genes to EMP2 Recombinant Protein (H00002013-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMP2 Recombinant Protein (H00002013-P01)

Discover more about diseases related to EMP2 Recombinant Protein (H00002013-P01).
 

Pathways for EMP2 Recombinant Protein (H00002013-P01)

View related products by pathway.

PTMs for EMP2 Recombinant Protein (H00002013-P01)

Learn more about PTMs related to EMP2 Recombinant Protein (H00002013-P01).

Blogs on EMP2

There are no specific blogs for EMP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EMP2 Antibody
NBP1-86847

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0

Anonymous
10/02/2015
Application: ELISA
Species: Human

Anonymous
03/13/2015
Application: WB
Species: Other

Bioinformatics

Gene Symbol EMP2
Entrez