EME2 Antibody

Images

 
Immunohistochemistry: EME2 Antibody [NBP2-30885] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EME2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQFSRVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EME2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EME2 Protein (NBP2-30885PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EME2 Antibody

  • EC 3.1.22
  • Essential Meiotic Endonuclease 1 Homolog 2 (S. Pombe)
  • Essential Meiotic Endonuclease 1 Homolog 2
  • Essential Meiotic Structure-Specific Endonuclease Subunit 2
  • gs125
  • Homolog Of Yeast EME1 Endonuclease 2
  • Probable Crossover Junction Endonuclease EME2
  • SLX2 Structure-Specific Endonuclease Subunit Homolog B (S. Cerevisiae)
  • SLX2 Structure-Specific Endonuclease Subunit Homolog B
  • SLX2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-176
Species: Hu, Pm, Mu(-)
Applications: WB, ICC/IF
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52574
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00146956-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32054
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
MAB4169
Species: Hu
Applications: WB, IHC
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-30885
Species: Hu
Applications: IHC, IHC-P

Publications for EME2 Antibody (NBP2-30885) (0)

There are no publications for EME2 Antibody (NBP2-30885).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EME2 Antibody (NBP2-30885) (0)

There are no reviews for EME2 Antibody (NBP2-30885). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EME2 Antibody (NBP2-30885) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EME2 Products

EME2 NBP2-30885

Bioinformatics Tool for EME2 Antibody (NBP2-30885)

Discover related pathways, diseases and genes to EME2 Antibody (NBP2-30885). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EME2 Antibody (NBP2-30885)

Discover more about diseases related to EME2 Antibody (NBP2-30885).
 

Pathways for EME2 Antibody (NBP2-30885)

View related products by pathway.

Blogs on EME2

There are no specific blogs for EME2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EME2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EME2
Uniprot