ELOVL5 Antibody - BSA Free

Western Blot: ELOVL5 Antibody [NBP3-35681] - Western blot analysis of lysates from HepG2 cells, using ELOVL5 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ELOVL5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ELOVL5 Antibody - BSA Free (NBP3-35681) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 247-326 of human ELOVL5 (NP_001229757.1).
  
  Sequence:
  GVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELOVL5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ELOVL5 Antibody - BSA Free

• dJ483K16.1
• EC 2.3.1.n8
• elongation of very long chain fatty acids protein 5
• ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2
• ELOVL2,3-keto acyl-CoA synthase ELOVL5
• Fatty acid elongase 1
• hELO1
• HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2
• homolog of yeast long chain polyunsaturated fatty acid elongatio
• SUR4/Elo3-like, yeast)

Background

ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELOVL5