Home » Elf4/MEF » Elf4/MEF Proteins » Elf4/MEF Recombinant Protein Antigen

Elf4/MEF Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Elf4/MEF Protein (NBP2-33286PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Elf4/MEF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ELF4.

Source: E.coli

Amino Acid Sequence: SSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVA
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ELF4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33286.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Elf4/MEF Recombinant Protein Antigen

  • E74-like factor 4 (ets domain transcription factor)
  • E74-like factor 4
  • ETS-related transcription factor Elf-4
  • MEFELFRMyeloid Elf-1-like factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
OCT4 Antibody
NB100-2379
Western Blot: OCT4 Antibody [NB100-2379] - YM155 significantly reduced tumorsphere formation and inhibited EGFR autophosphorylation and G9a expression. YM155 is reported to suppress cancer stemness; therefore, we used this compound to investigate the cellular mechanism of tumorsphere formation. To compare the cytotoxic capacity of YM155 against tumorsphere formation and parental cell lines, YM155 was applied to HCC827 and A549 cells in the stemness cultured or integrated medium. (F) Moreover, YM155 inhibited EGFR autophosphorylation in A549-derived tumorspheres and reduced Oct4 expression. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0182149) licensed under a CC-BY licence.
Western Blot: OCT4 Antibody [NB100-2379] - WB detection of OCT4 in mouse brain lysate using OCT4 antibody with ECL based detection. The antibody generated a specific band of OCT4 at the expected ~40kDa position.
Flow Cytometry: OCT4 Antibody [NB100-2379] - An intracellular stain was performed on Jurkat with NB100-2379 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
(2 Reviews)
(17 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Pet1 Antibody
NBP2-85457
Western Blot: Pet1 Antibody [NBP2-85457] - Host: Rabbit. Target Name: FEV. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Species: Hu
Applications: WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(14 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(33 Reviews)
(647 Publications)
Species: Hu
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
FGF
basic/FGF2/bFGF [Unco
233-FB/CF
Recombinant Human FGF basic/FGF2/bFGF (146 aa) (Catalog # 233-FB/CF) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The activity is approximately 3-fold greater than the top competitor's FGF basic (146 aa).
1 µg/lane of Recombinant Human FGF basic/FGF2/bFGF (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(369 Publications)
Species: Hu
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
LIF Antibody
(39N7D10)
NBP2-27406
Western Blot: LIF Antibody (39N7D10) [NBP2-27406] - LIF expression in human primary T-cells and cancer cell lines: Jurkat and K562. Image from verified customer review.
Immunohistochemistry-Paraffin: LIF Antibody (39N7D10) [NBP2-27406] - Tissue section of mouse brain using 5 ug/ml concentration of LIF antibody (clone 39N7D10).
Western Blot: LIF Antibody (39N7D10) [NBP2-27406] - WB validation of LIF antibody (clone 39N7D10) on (A) full-length recombinant Lif protein, (B) mouse spleen lysate and (C) human spleen lysate. 3 ug/mL concentration of primary antibody, Goat anti-rat IgG HRP secondary antibody and PicoTect ECL substrate solution were used for this assay.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western blot shows lysates of CHP-100 human neuroblastoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Western blot shows recombinant human JNK1, JNK2, and JNK3 (1 ng/lane). PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
JNK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC
Ets-1 Antibody
(JM92-32)
NBP2-66826
Western Blot: Ets-1 Antibody (JM92-32) [NBP2-66826] - Analysis of ETS1 on different cell lysates using anti-ETS1 antibody at 1/1,000 dilution. Positive control: Line1: Jurkat Line2: K562 Line3: HepG2
Immunohistochemistry-Paraffin: Ets-1 Antibody (JM92-32) [NBP2-66826] - Analysis of paraffin-embedded mouse spleen tissue using anti-ETS1 antibody. Counter stained with hematoxylin.
Flow Cytometry: Ets-1 Antibody (JM92-32) [NBP2-66826] - Analysis of Jurkat cells with ETS1 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
IL-6 [HRP]
D6050
(25 Reviews)
(466 Publications)
Species: Hu
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image using the Alexa Fluor 488 format of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(49 Publications)
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP

TMEFF2/Tomoregulin-2 A
NBP2-01863
Western Blot: TMEFF2 Antibody (1F9) [NBP2-01863] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TMEFF2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-TMEFF2.
Immunohistochemistry-Paraffin: TMEFF2 Antibody (1F9) [NBP2-01863] Staining of paraffin-embedded Human tonsil using anti-TMEFF2 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: TMEFF2 Antibody (1F9) [NBP2-01863] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-TMEFF2 mouse monoclonal antibody.
Species: Hu
Applications: WB, IHC, IHC-P
PAR1/Thrombin
Receptor Antibody (N2
NBP1-71770
Western Blot: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor expression in human testis using NBP1-71770.
Immunocytochemistry/Immunofluorescence: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - PAR1 is expressed by neural stem cells in the sub-ventricular zone (SVZ) of the adult mouse brain. Photomicrographs show immunofluorescence double-labeling for PAR1 with Sox2-positive. Multipotent neural stem cells (NSCs) within the lateral wall of the lateral ventricle (LV). Image collected and cropped by Cite Ab from the following publication (The Thrombin Receptor Restricts Subventricular Zone Neural Stem Cell Expansion and Differentiation. Sci Rep (2018) licensed under a CC-BY licence.
Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor on mouse skin using NBP1-71770.
(7 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
TXNRD2 Antibody
NBP1-86919
Western Blot: TXNRD2 Antibody [NBP1-86919] - Analysis in human cell line K562.
Immunohistochemistry-Paraffin: TXNRD2 Antibody [NBP1-86919] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(4 Publications)
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Elf4/MEF Protein (NBP2-33286PEP) (0)

There are no publications for Elf4/MEF Protein (NBP2-33286PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Elf4/MEF Protein (NBP2-33286PEP) (0)

There are no reviews for Elf4/MEF Protein (NBP2-33286PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Elf4/MEF Protein (NBP2-33286PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional Elf4/MEF Products

Bioinformatics Tool for Elf4/MEF Protein (NBP2-33286PEP)

Discover related pathways, diseases and genes to Elf4/MEF Protein (NBP2-33286PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Elf4/MEF Protein (NBP2-33286PEP)

Discover more about diseases related to Elf4/MEF Protein (NBP2-33286PEP).
 

Pathways for Elf4/MEF Protein (NBP2-33286PEP)

View related products by pathway.

PTMs for Elf4/MEF Protein (NBP2-33286PEP)

Learn more about PTMs related to Elf4/MEF Protein (NBP2-33286PEP).
 

Research Areas for Elf4/MEF Protein (NBP2-33286PEP)

Find related products by research area.

Blogs on Elf4/MEF

There are no specific blogs for Elf4/MEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
IL-6 [HRP]
IL-6 [HRP]
D6050

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Elf4/MEF Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ELF4