ELA3A Recombinant Protein Antigen

Images

 
There are currently no images for ELA3A Recombinant Protein Antigen (NBP2-58716PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ELA3A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ELA3A.

Source: E. coli

Amino Acid Sequence: HTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDIL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CELA3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58716.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ELA3A Recombinant Protein Antigen

  • chymotrypsin-like elastase family member 3A
  • chymotrypsin-like elastase family, member 3A
  • EC 3.4.21
  • EC 3.4.21.70
  • ELA3A
  • ELA3elastase 1
  • elastase 3A, pancreatic (protease E)
  • elastase 3A, pancreatic
  • Elastase IIIA
  • elastase-3A
  • Protease E

Background

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3A has little elastolytic activity. Like most of the human elastases, elastase 3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3A preferentially cleaves proteins after alanine residues. Elastase 3A may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
H00006690-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00001990-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB5018
Species: Hu
Applications: IP, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P
AF4478
Species: Hu
Applications: IHC, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-41306
Species: Hu, Mu, Rt
Applications: WB
DY4517-05
Species: Mu
Applications: ELISA
NBP3-15533
Species: Mu, Rt
Applications: ICC/IF, IHC, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF1657
Species: Mu
Applications: WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
DY1707
Species: Hu
Applications: ELISA
AF3848
Species: Hu
Applications: IHC, IP, WB
NBP2-62664
Species: Hu
Applications: IHC,  IHC-P

Publications for ELA3A Recombinant Protein Antigen (NBP2-58716PEP) (0)

There are no publications for ELA3A Recombinant Protein Antigen (NBP2-58716PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELA3A Recombinant Protein Antigen (NBP2-58716PEP) (0)

There are no reviews for ELA3A Recombinant Protein Antigen (NBP2-58716PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ELA3A Recombinant Protein Antigen (NBP2-58716PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ELA3A Products

Research Areas for ELA3A Recombinant Protein Antigen (NBP2-58716PEP)

Find related products by research area.

Blogs on ELA3A

There are no specific blogs for ELA3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ELA3A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CELA3A