EIF4EBP3 Antibody (4C1)

Images

 
Western Blot: EIF4EBP3 Antibody (4C1) [H00008637-M05] - Analysis of EIF4EBP3 expression in transfected 293T cell line by EIF4EBP3 monoclonal antibody (M05), clone 4C1. Lane 1: EIF4EBP3 transfected lysatE (10.873 KDa). ...read more
Immunocytochemistry/ Immunofluorescence: EIF4EBP3 Antibody (4C1) [H00008637-M05] - Analysis of monoclonal antibody to EIF4EBP3 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EIF4EBP3 Antibody (4C1) Summary

Immunogen
EIF4EBP3 (NP_003723, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
Specificity
EIF4EBP3 - eukaryotic translation initiation factor 4E binding protein 3 (4C1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EIF4EBP3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EIF4EBP3 Antibody (4C1)

  • eIF4E-binding protein 3
  • eukaryotic translation initiation factor 4E binding protein 3,4E-BP3eukaryotic initiation factor 4E-binding protein 3
  • eukaryotic translation initiation factor 4E-binding protein 3,4EBP3

Background

This gene encodes a member of the EIF4EBP family which derives it name from proteins that bind to eukaryotic initiation factor 4E and that prevent its assembly into EIF4F. Co-transcription of this gene and the neighboring upstream gene (MASK) generates a transcript (MASK-BP3) which encodes a fusion protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19270
Species: Hu, Mu, Rt, Po, Bv, Ca, Rb
Applications: WB, IHC
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-184
Species: Hu, Mu
Applications: WB, IP
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
H00404734-R01
Species: Hu

Publications for EIF4EBP3 Antibody (H00008637-M05) (0)

There are no publications for EIF4EBP3 Antibody (H00008637-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF4EBP3 Antibody (H00008637-M05) (0)

There are no reviews for EIF4EBP3 Antibody (H00008637-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EIF4EBP3 Antibody (H00008637-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF4EBP3 Products

Bioinformatics Tool for EIF4EBP3 Antibody (H00008637-M05)

Discover related pathways, diseases and genes to EIF4EBP3 Antibody (H00008637-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF4EBP3 Antibody (H00008637-M05)

Discover more about diseases related to EIF4EBP3 Antibody (H00008637-M05).
 

Pathways for EIF4EBP3 Antibody (H00008637-M05)

View related products by pathway.

PTMs for EIF4EBP3 Antibody (H00008637-M05)

Learn more about PTMs related to EIF4EBP3 Antibody (H00008637-M05).

Blogs on EIF4EBP3

There are no specific blogs for EIF4EBP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF4EBP3 Antibody (4C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4EBP3
Entrez
Uniprot