EIF3S3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

EIF3S3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF3H.
  
  

  Source: E. coli

  Amino Acid Sequence: QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: EIF3H
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84870. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EIF3S3 Recombinant Protein Antigen

• eIF-3-gamma
• eIF3-gamma
• eIF3h
• eIF3-p40
• EIF3S3eIF3 p40 subunit
• Eukaryotic translation initiation factor 3 subunit 3
• eukaryotic translation initiation factor 3 subunit H
• eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD)
• eukaryotic translation initiation factor 3, subunit 3 (gamma, 40kD)
• eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa
• eukaryotic translation initiation factor 3, subunit H
• MGC102958

Background

Eukaryotic initiation factor 3 subunit H (eIF3H) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3H is a non-conserved subunit and part of the functional core of eIF3. It may function to stabilize the eIF3 complex and stimulate protein synthesis. Many cancer cell lines have been shown to express high levels of eIF3H, and it may have an oncogenic role in colorectal cancer susceptibility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: EIF3H