EIF3S3 Recombinant Protein Antigen

Images

 
There are currently no images for EIF3S3 Protein (NBP1-84870PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EIF3S3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF3H.

Source: E. coli

Amino Acid Sequence: QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF3H
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84870.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EIF3S3 Recombinant Protein Antigen

  • eIF-3-gamma
  • eIF3-gamma
  • eIF3h
  • eIF3-p40
  • EIF3S3eIF3 p40 subunit
  • Eukaryotic translation initiation factor 3 subunit 3
  • eukaryotic translation initiation factor 3 subunit H
  • eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD)
  • eukaryotic translation initiation factor 3, subunit 3 (gamma, 40kD)
  • eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa
  • eukaryotic translation initiation factor 3, subunit H
  • MGC102958

Background

Eukaryotic initiation factor 3 subunit H (eIF3H) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3H is a non-conserved subunit and part of the functional core of eIF3. It may function to stabilize the eIF3 complex and stimulate protein synthesis. Many cancer cell lines have been shown to express high levels of eIF3H, and it may have an oncogenic role in colorectal cancer susceptibility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
409-ML
Species: Mu
Applications: BA
NBP3-38366
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-81796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-32956
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP1-84869
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-91875
Species: Hu, Mu
Applications: IHC,  IHC-P
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP1-18891
Species: Hu, Mu
Applications: IP, WB
AF4838
Species: Hu
Applications: Simple Western, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NBP1-84874
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for EIF3S3 Protein (NBP1-84870PEP) (0)

There are no publications for EIF3S3 Protein (NBP1-84870PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF3S3 Protein (NBP1-84870PEP) (0)

There are no reviews for EIF3S3 Protein (NBP1-84870PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EIF3S3 Protein (NBP1-84870PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EIF3S3 Products

Research Areas for EIF3S3 Protein (NBP1-84870PEP)

Find related products by research area.

Blogs on EIF3S3

There are no specific blogs for EIF3S3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EIF3S3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3H