Recombinant Human eIF3e Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human eIF3e Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 346 - 445 of Human EIF3S6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EIF3E
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human eIF3e Protein

  • eIF-3 p48
  • eIF3e
  • eIF3-p48
  • EIF3S6EIF3-P48
  • Eukaryotic translation initiation factor 3 subunit 6
  • eukaryotic translation initiation factor 3 subunit E
  • eukaryotic translation initiation factor 3, subunit 6 (48kD)
  • eukaryotic translation initiation factor 3, subunit 6 48kDa
  • eukaryotic translation initiation factor 3, subunit E
  • INT6eIF3-p46
  • mammary tumor-associated protein INT6
  • murine mammary tumor integration site 6 (oncogene homolog)
  • Viral integration site protein INT-6 homolog

Background

EIF3S6 - eukaryotic translation initiation factor 3, subunit 6 48kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-44179
Species: Mu
Applications: WB, ELISA
AF5629
Species: Hu, Mu
Applications: WB
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP1-77997
Species: Hu, Mu, Rt, Bv, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-84870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-24468
Species: Hu, Mu, Rt, Pm, Ze
Applications: WB
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NB100-368
Species: Hu
Applications: WB
AF1620
Species: Mu
Applications: WB, IHC

Publications for eIF3e Partial Recombinant Protein (H00003646-Q01) (0)

There are no publications for eIF3e Partial Recombinant Protein (H00003646-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF3e Partial Recombinant Protein (H00003646-Q01) (0)

There are no reviews for eIF3e Partial Recombinant Protein (H00003646-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eIF3e Partial Recombinant Protein (H00003646-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eIF3e Products

Bioinformatics Tool for eIF3e Partial Recombinant Protein (H00003646-Q01)

Discover related pathways, diseases and genes to eIF3e Partial Recombinant Protein (H00003646-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF3e Partial Recombinant Protein (H00003646-Q01)

Discover more about diseases related to eIF3e Partial Recombinant Protein (H00003646-Q01).
 

Pathways for eIF3e Partial Recombinant Protein (H00003646-Q01)

View related products by pathway.

PTMs for eIF3e Partial Recombinant Protein (H00003646-Q01)

Learn more about PTMs related to eIF3e Partial Recombinant Protein (H00003646-Q01).

Blogs on eIF3e

There are no specific blogs for eIF3e, but you can read our latest blog posts.

Customers Who Bought This Also Bought

eIF3e Antibody
NBP1-84869
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human eIF3e Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3E