Recombinant Human eIF3e GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human eIF3e GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 346-445 of Human eIF3e

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
EIF3E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human eIF3e GST (N-Term) Protein

  • eIF-3 p48
  • eIF3e
  • eIF3-p48
  • EIF3S6EIF3-P48
  • Eukaryotic translation initiation factor 3 subunit 6
  • eukaryotic translation initiation factor 3 subunit E
  • eukaryotic translation initiation factor 3, subunit 6 (48kD)
  • eukaryotic translation initiation factor 3, subunit 6 48kDa
  • eukaryotic translation initiation factor 3, subunit E
  • INT6eIF3-p46
  • mammary tumor-associated protein INT6
  • murine mammary tumor integration site 6 (oncogene homolog)
  • Viral integration site protein INT-6 homolog

Background

EIF3S6 - eukaryotic translation initiation factor 3, subunit 6 48kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010920-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-16991
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-47427
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90256
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-16299
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
NBP1-84870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38747
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
1206-F3/CF
Species: Hu
NB600-302
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Flow-IC
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Rb, Re, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PAGE, Dual ISH-IHC, KD, KO
NBP2-24468
Species: Hu, Mu, Rt, Pm, Ze
Applications: WB
NB100-268
Species: Hu, Po
Applications: WB, IP
NB100-368
Species: Hu, Mu
Applications: WB
NBP1-51575
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for eIF3e Partial Recombinant Protein (H00003646-Q01) (0)

There are no publications for eIF3e Partial Recombinant Protein (H00003646-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF3e Partial Recombinant Protein (H00003646-Q01) (0)

There are no reviews for eIF3e Partial Recombinant Protein (H00003646-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eIF3e Partial Recombinant Protein (H00003646-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional eIF3e Products

Bioinformatics Tool for eIF3e Partial Recombinant Protein (H00003646-Q01)

Discover related pathways, diseases and genes to eIF3e Partial Recombinant Protein (H00003646-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF3e Partial Recombinant Protein (H00003646-Q01)

Discover more about diseases related to eIF3e Partial Recombinant Protein (H00003646-Q01).
 

Pathways for eIF3e Partial Recombinant Protein (H00003646-Q01)

View related products by pathway.

PTMs for eIF3e Partial Recombinant Protein (H00003646-Q01)

Learn more about PTMs related to eIF3e Partial Recombinant Protein (H00003646-Q01).

Blogs on eIF3e

There are no specific blogs for eIF3e, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human eIF3e GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3E