eIF2B3 Antibody

Images

 
Western Blot: eIF2B3 Antibody [NBP1-83986] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: eIF2B3 Antibody [NBP1-83986] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: eIF2B3 Antibody [NBP1-83986] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

eIF2B3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF2B3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
eIF2B3 Protein (NBP1-83986PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for eIF2B3 Antibody

  • eIF-2B GDP-GTP exchange factor subunit gamma
  • EIF-2B
  • EIF2Bgamma
  • eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD)
  • eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
  • translation initiation factor eIF-2B subunit gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02669
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83210
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58544
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-38572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16293
Species: Hu
Applications: WB, ICC/IF
NBP2-38126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32783
Species: Hu, Mu
Applications: WB, ICC/IF
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-83986
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for eIF2B3 Antibody (NBP1-83986) (0)

There are no publications for eIF2B3 Antibody (NBP1-83986).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF2B3 Antibody (NBP1-83986) (0)

There are no reviews for eIF2B3 Antibody (NBP1-83986). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for eIF2B3 Antibody (NBP1-83986) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional eIF2B3 Products

Bioinformatics Tool for eIF2B3 Antibody (NBP1-83986)

Discover related pathways, diseases and genes to eIF2B3 Antibody (NBP1-83986). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF2B3 Antibody (NBP1-83986)

Discover more about diseases related to eIF2B3 Antibody (NBP1-83986).
 

Pathways for eIF2B3 Antibody (NBP1-83986)

View related products by pathway.

Blogs on eIF2B3

There are no specific blogs for eIF2B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eIF2B3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2B3