Recombinant Human EIF2 beta Protein

Images

 
SDS-Page: Recombinant Human EIF2 beta Protein [H00008894-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

Recombinant Human EIF2 beta Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-333 of Human EIF2S2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
EIF2S2

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EIF2 beta Protein

  • DKFZp686L18198
  • EIF2
  • EIF2B
  • EIF2beta
  • eIF-2-beta
  • eukaryotic initiation factor 2-beta
  • eukaryotic translation initiation factor 2 beta
  • eukaryotic translation initiation factor 2 subunit 2
  • Eukaryotic translation initiation factor 2 subunit beta
  • eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD )
  • eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
  • MGC8508

Background

Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32783
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-86184
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-03605
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00008894-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE

Publications for EIF2 beta Recombinant Protein (H00008894-P01) (0)

There are no publications for EIF2 beta Recombinant Protein (H00008894-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2 beta Recombinant Protein (H00008894-P01) (0)

There are no reviews for EIF2 beta Recombinant Protein (H00008894-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF2 beta Recombinant Protein (H00008894-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EIF2 beta Products

Bioinformatics Tool for EIF2 beta Recombinant Protein (H00008894-P01)

Discover related pathways, diseases and genes to EIF2 beta Recombinant Protein (H00008894-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF2 beta Recombinant Protein (H00008894-P01)

Discover more about diseases related to EIF2 beta Recombinant Protein (H00008894-P01).
 

Pathways for EIF2 beta Recombinant Protein (H00008894-P01)

View related products by pathway.

Research Areas for EIF2 beta Recombinant Protein (H00008894-P01)

Find related products by research area.

Blogs on EIF2 beta

There are no specific blogs for EIF2 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

4EBP1 Antibody
NB200-157

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EIF2 beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2S2