EID1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EID1 Antibody [NBP2-47355] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: EID1 Antibody [NBP2-47355] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EID1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EID1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
EID1 Protein (NBP2-47355PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EID1 Antibody

  • 21 kDa pRb-associated protein
  • C15orf3PTD014
  • CREBBP/EP300 inhibitor 1
  • CREBBP/EP300 inhibitory protein 1MGC138884
  • CRI1EP300-interacting inhibitor of differentiation 1
  • E1A-like inhibitor of differentiation 1
  • EID-1MGC138883
  • EP300 interacting inhibitor of differentiation 1
  • IRO45620
  • NB4 apoptosis related protein
  • Rb- and p300-binding protein EID-1
  • RBP21
  • retinoblastoma protein-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-46522
Species: Hu
Applications: WB, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94096
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46214
Species: Hu
Applications: WB, IHC
NBP2-38048
Species: Hu
Applications: IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NBP2-32455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP

Publications for EID1 Antibody (NBP2-47355) (0)

There are no publications for EID1 Antibody (NBP2-47355).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EID1 Antibody (NBP2-47355) (0)

There are no reviews for EID1 Antibody (NBP2-47355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EID1 Antibody (NBP2-47355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EID1 Products

Bioinformatics Tool for EID1 Antibody (NBP2-47355)

Discover related pathways, diseases and genes to EID1 Antibody (NBP2-47355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EID1 Antibody (NBP2-47355)

Discover more about diseases related to EID1 Antibody (NBP2-47355).
 

Pathways for EID1 Antibody (NBP2-47355)

View related products by pathway.

PTMs for EID1 Antibody (NBP2-47355)

Learn more about PTMs related to EID1 Antibody (NBP2-47355).
 

Research Areas for EID1 Antibody (NBP2-47355)

Find related products by research area.

Blogs on EID1

There are no specific blogs for EID1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EID1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EID1