EHF Recombinant Protein Antigen

Images

 
There are currently no images for EHF Protein (NBP2-38896PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EHF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EHF.

Source: E. coli

Amino Acid Sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EHF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38896.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EHF Recombinant Protein Antigen

  • Epithelium-specific Ets transcription factor 3
  • ESE3 transcription factor
  • ESE-3
  • ESE3B
  • ESE3hEHF
  • ESEJepithelium-specific ets factor 3
  • ETS domain-containing transcription factor
  • ets homologous factor

Background

ETS homologous factor (ETS), also known as ETS domain-containing transcription factor, epithelium-specific ETS transcription factor 3, EHF, ESE3, ESE3B, and ESEJ, is a member of the ETS family. This family is characterized by epithelial-specific expression (ESEs). ETS acts as a transcriptional repressor for a specific subset of ETS/AP-1 responsive genes and a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. As such, ETS may play a role in epithelial differentiation and carcinogenesis. ETS is also involved in TNFRSF10B/DR5 regulation through the ETS-binding sequences on the TNFRSF10B/DR5 promoter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30873
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP3-04468
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-86950
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-04686
Species: Hu
Applications: ELISA, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF2905
Species: Hu
Applications: ELISA, ICC, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA

Publications for EHF Protein (NBP2-38896PEP) (0)

There are no publications for EHF Protein (NBP2-38896PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EHF Protein (NBP2-38896PEP) (0)

There are no reviews for EHF Protein (NBP2-38896PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EHF Protein (NBP2-38896PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EHF Products

Array NBP2-38896PEP

Research Areas for EHF Protein (NBP2-38896PEP)

Find related products by research area.

Blogs on EHF

There are no specific blogs for EHF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EHF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EHF