Recombinant Human EHD3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EHD3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 357-406 of Human EHD3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EHD3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EHD3 Protein

  • EH domain containing 3
  • EH domain-containing protein 3
  • EHD2
  • EH-domain containing 3
  • PAST homolog 3
  • PAST3

Background

EHD3 - EH-domain containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56035
Species: Hu
Applications: WB, ICC/IF
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-16287
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24481
Species: Hu, Pm, Xp
Applications: WB, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33756
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NBP1-93614
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87283
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-88932
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
H00030845-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for EHD3 Partial Recombinant Protein (H00030845-Q01) (0)

There are no publications for EHD3 Partial Recombinant Protein (H00030845-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EHD3 Partial Recombinant Protein (H00030845-Q01) (0)

There are no reviews for EHD3 Partial Recombinant Protein (H00030845-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EHD3 Partial Recombinant Protein (H00030845-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EHD3 Products

Bioinformatics Tool for EHD3 Partial Recombinant Protein (H00030845-Q01)

Discover related pathways, diseases and genes to EHD3 Partial Recombinant Protein (H00030845-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EHD3 Partial Recombinant Protein (H00030845-Q01)

Discover more about diseases related to EHD3 Partial Recombinant Protein (H00030845-Q01).
 

Pathways for EHD3 Partial Recombinant Protein (H00030845-Q01)

View related products by pathway.

PTMs for EHD3 Partial Recombinant Protein (H00030845-Q01)

Learn more about PTMs related to EHD3 Partial Recombinant Protein (H00030845-Q01).

Blogs on EHD3

There are no specific blogs for EHD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EHD3 Antibody (4B7)
H00030845-M01
ARID1A Antibody
NBP1-88932

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EHD3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EHD3