Recombinant Human EGR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EGR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human EGR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EGR1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EGR1 Protein

  • AT225Transcription factor ETR103
  • early growth response 1
  • early growth response protein 1
  • EGR1
  • EGR-1
  • G0S30
  • KROX24
  • KROX-24
  • Nerve growth factor-induced protein A
  • NGFIA
  • NGFI-ATranscription factor Zif268
  • TIS8
  • ZIF-268
  • Zinc finger protein Krox-24
  • ZNF225
  • ZNF225Zinc finger protein 225

Background

EGR1 - early growth response 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NB100-56530
Species: Hu
Applications: WB
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80903
Species: Hu
Applications: IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5526
Species: Hu, Mu
Applications: WB
H00001958-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for EGR1 Partial Recombinant Protein (H00001958-Q01) (0)

There are no publications for EGR1 Partial Recombinant Protein (H00001958-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EGR1 Partial Recombinant Protein (H00001958-Q01) (0)

There are no reviews for EGR1 Partial Recombinant Protein (H00001958-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EGR1 Partial Recombinant Protein (H00001958-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EGR1 Products

Bioinformatics Tool for EGR1 Partial Recombinant Protein (H00001958-Q01)

Discover related pathways, diseases and genes to EGR1 Partial Recombinant Protein (H00001958-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EGR1 Partial Recombinant Protein (H00001958-Q01)

Discover more about diseases related to EGR1 Partial Recombinant Protein (H00001958-Q01).
 

Pathways for EGR1 Partial Recombinant Protein (H00001958-Q01)

View related products by pathway.

PTMs for EGR1 Partial Recombinant Protein (H00001958-Q01)

Learn more about PTMs related to EGR1 Partial Recombinant Protein (H00001958-Q01).
 

Research Areas for EGR1 Partial Recombinant Protein (H00001958-Q01)

Find related products by research area.

Blogs on EGR1.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

No Monkey Business: APE1 is a Critical DNA Repair Enzyme
APE1 (aka. HAP1, /Ref-1 or APEX) the mammalian ortholog of Escherichia coli Xth is a multifunctional protein possessing both DNA repair and transcriptional regulatory activity. APE1 acts essentially as master regulator of controlling cellular response...  Read full blog post.

Customers Who Bought This Also Bought

EGR1 Antibody (6E8.)
H00001958-M03

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EGR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EGR1
Entrez