Recombinant Human EGLN1/PHD2 GST (N-Term) Protein

Images

 
Recombinant Human EGLN1/PHD2 GST (N-Term) Protein [H00054583-P01] - Analysis by 12.5% SDS-PAGE. Gel stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, In vitro, PA, AP, Enzyme Activity

Order Details

Recombinant Human EGLN1/PHD2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-128 of Human EGLN1 full-length ORF.

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF

Preparation
Method
In vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
EGLN1
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
H00054583-P01 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
Elution buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EGLN1/PHD2 GST (N-Term) Protein

  • C1orf12
  • EC 1.14.11.29
  • EC:1.14.11.291
  • ECYT3
  • egl nine homolog 1
  • egl nine-like protein 1
  • EGLN1
  • HALAH
  • HIF prolyl hydroxylase 2
  • HIFPH2
  • HIF-PH2
  • HIF-prolyl hydroxylase 2
  • HPH2
  • HPH-2
  • Hypoxia-inducible factor prolyl hydroxylase 2
  • PHD2
  • PNAS-118
  • PNAS-137
  • Prolyl hydroxylase domain-containing protein 2
  • SM20
  • SM-20
  • zinc finger MYND domain-containing protein 6
  • ZMYND6

Background

PHD2 (Prolyl Hydroxylase Domain-containing protein 2) belongs to the Prolyl-4-hydroxylase domain (PHD) family of proteins and is encoded by the Egl-9 Family Hypoxia Inducible Factor 1 (EGLN1) gene (1). Human EGLN1/PHD2 is a ubiquitously expressed enzyme that is 426 amino acids (aa) long with a theoretical molecular weight of ~46 kDa. Structurally PHD2 contains a nuclear export signal (NES, aa 6-20), an N-terminal MYND zinc finger domain (aa 21-58), and a C-terminal catalytic domain (aa 291-392) (2, 3). Functionally, PHD2 serves as an oxygen sensor and is responsible for post-translational modification of Hypoxia-inducible factor alpha (HIF-1alpha), a component of a transcriptional complex involved in oxygen homeostasis (1-3). During normoxia, PHD2 is responsible for oxygen-dependent hydroxylation of HIF-1alpha proline residue 402, 564, or both (3). The hydroxylation event promotes the binding of von Hippel-Lindau protein (VHL) and targets HIF1-alpha for ubiquitination and degradation (4, 5).

EGLN1/PHD2 has been implicated in several critical processes including erythropoiesis, angiogenesis, and metabolism as well as various pathologies such as cancer (2, 5, 6). Studies in mice have found that somatic deletion of PHD2 resulted in higher vascular endothelial growth factor A (VEGF-A) levels, increased blood vessel formation, and more erythropoietin (EPO), leading to severe polycythemia or erythrocytosis (high red blood cell (RBC) volume) (6). Another study revealed that specific point mutations in EGLN1/PHD2 led to elevated EPO and RBC mass associated with hemorrhages and strokes (6). Accordingly, given the known role of PHD2 in inhibition of EPO production, PHD2 inhibitors are being studied as a potential therapeutic for anemia (6). Additionally, dysregulation in EGLN1, and specifically the PHD2-VHL-HIF-1alpha pathway, has been associated with the development of pheochromocytomas (PCC) and sympathetic paragangliomas (PGL), which are rare neuroendocrine tumors (2). Besides pathological features, EGLN1/PHD2 may also be important for high altitude adaptation as two coding sequence variants in PHD2 are prevalent in the Tibetan population but is very rare in people at lower altitudes (2).

Alternate names for EGLN1/PHD2 include HIF Prolyl Hydroxylase 2, PH2, Prolyl hydroxylase domain containing protein 2, HIF2PH2, HIF-Prolyl hydroxylase 2, egl nine homolog 1, and C1orf12.

References

1. Amorim-Pires, D., Peixoto, J., & Lima, J. (2016). Hypoxia Pathway Mutations in Pheochromocytomas and Paragangliomas. Cytogenetic and genome research. https://doi.org/10.1159/000457479

2. Gardie, B., Percy, M. J., Hoogewijs, D., Chowdhury, R., Bento, C., Arsenault, P. R., Richard, S., Almeida, H., Ewing, J., Lambert, F., McMullin, M. F., Schofield, C. J., & Lee, F. S. (2014). The role of PHD2 mutations in the pathogenesis of erythrocytosis. Hypoxia (Auckland, N.Z.). https://doi.org/10.2147/HP.S54455

3. Minervini, G., Quaglia, F., & Tosatto, S. C. (2015). Insights into the proline hydroxylase (PHD) family, molecular evolution and its impact on human health. Biochimie. https://doi.org/10.1016/j.biochi.2015.07.009

4. Semenza G. L. (2007). Hypoxia-inducible factor 1 (HIF-1) pathway. Science's STKE : signal transduction knowledge environment. https://doi.org/10.1126/stke.4072007cm8

5. Chan, D. A., & Giaccia, A. J. (2010). PHD2 in tumour angiogenesis. British journal of cancer. https://doi.org/10.1038/sj.bjc.6605682

6. Meneses, A. M., & Wielockx, B. (2016). PHD2: from hypoxia regulation to disease progression. Hypoxia (Auckland, N.Z.). https://doi.org/10.2147/HP.S53576

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KO, LA
NB100-139
Species: Hu, Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP, KD
AF6394
Species: Hu
Applications: WB, IP
H00007428-D01P
Species: Hu, Mu
Applications: WB
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Rb, Re, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PAGE, Dual ISH-IHC, KD, KO
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
NB100-428
Species: Hu, Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ma, Pm, Sh
Applications: WB, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, CHIP-SEQ
NBP2-13967
Species: Hu
Applications: WB, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, Dual ISH-IHC, KO
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: EnzAct, In vitro.


Filter By Application
EnzAct
(1)
In vitro
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01) (0)

There are no reviews for EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional EGLN1/PHD2 Products

Bioinformatics Tool for EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01)

Discover related pathways, diseases and genes to EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01)

Discover more about diseases related to EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01).
 

Pathways for EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01)

View related products by pathway.

PTMs for EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01)

Learn more about PTMs related to EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01).
 

Research Areas for EGLN1/PHD2 Full Length Recombinant Protein (H00054583-P01)

Find related products by research area.

Blogs on EGLN1/PHD2

There are no specific blogs for EGLN1/PHD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EGLN1/PHD2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EGLN1