EFHB Antibody

Images

 
Western Blot: EFHB Antibody [NBP2-82976] - Host: Rabbit. Target Name: EFHB. Sample Type: HepG2 Whole cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EFHB Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human EFHB. Peptide sequence: YGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
EFHB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EFHB Antibody

  • EF-hand domain family, member B
  • EF-hand domain-containing family member B
  • FLJ25200

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
MAB3428
Species: Hu
Applications: WB, IHC
NB120-6405
Species: Mu, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
6507-IL/CF
Species: Hu
NBP2-66778
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB100-82001
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
230-4RB
Species: Hu
AF2614
Species: Hu
Applications: WB, ICC
NBP2-32387
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NB100-39002
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western
NBP2-92637
Species: Hu, Rt
Applications: WB, ICC/IF
NB110-1244
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-30214
Species: Hu

Publications for EFHB Antibody (NBP2-82976) (0)

There are no publications for EFHB Antibody (NBP2-82976).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EFHB Antibody (NBP2-82976) (0)

There are no reviews for EFHB Antibody (NBP2-82976). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EFHB Antibody (NBP2-82976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EFHB Products

Bioinformatics Tool for EFHB Antibody (NBP2-82976)

Discover related pathways, diseases and genes to EFHB Antibody (NBP2-82976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EFHB Antibody (NBP2-82976)

Discover more about diseases related to EFHB Antibody (NBP2-82976).

Blogs on EFHB

There are no specific blogs for EFHB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EFHB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EFHB