EEF1B2 Antibody

Images

 
Western Blot: EEF1B2 Antibody [NBP2-37875] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: EEF1B2 Antibody [NBP2-37875] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli fibrillar center & cytosol.
Immunohistochemistry-Paraffin: EEF1B2 Antibody [NBP2-37875] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EEF1B2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATD
Specificity
Specificity of human EEF1B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EEF1B2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
EEF1B2 Lysate (NBP2-66024)
Control Peptide
EEF1B2 Protein (NBP2-37875PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EEF1B2 Antibody

  • EEF1B
  • EEF1B1
  • EF1B
  • EF-1-beta
  • elongation factor 1-beta
  • eukaryotic translation elongation factor 1 beta 1
  • eukaryotic translation elongation factor 1 beta 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-513
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-98474
Species: Hu
Applications: WB
NBP1-49832
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27072
Species: Hu, Am, Bv, Ca, Eq, Op, Pm
Applications: WB, IHC-P
NBP1-81714
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
NBP2-37875
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EEF1B2 Antibody (NBP2-37875) (0)

There are no publications for EEF1B2 Antibody (NBP2-37875).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EEF1B2 Antibody (NBP2-37875) (0)

There are no reviews for EEF1B2 Antibody (NBP2-37875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EEF1B2 Antibody (NBP2-37875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EEF1B2 Antibody (NBP2-37875)

Discover related pathways, diseases and genes to EEF1B2 Antibody (NBP2-37875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEF1B2 Antibody (NBP2-37875)

Discover more about diseases related to EEF1B2 Antibody (NBP2-37875).
 

Pathways for EEF1B2 Antibody (NBP2-37875)

View related products by pathway.

Blogs on EEF1B2

There are no specific blogs for EEF1B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EEF1B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EEF1B2
Uniprot