EDEM3 Antibody - BSA Free

Immunohistochemistry-Paraffin: EDEM3 Antibody [NBP1-88342] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EDEM3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EDEM3 Antibody - BSA Free (NBP1-88342) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-EDEM3 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YLYLLFADKEDIIFDIEDYIFTTEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPL
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EDEM3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID:33398021)
• Control Peptide:

  EDEM3 Recombinant Protein Antigen (NBP1-88342PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33398021)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EDEM3 Antibody - BSA Free

• C1orf22
• chromosome 1 open reading frame 22
• ER degradation enhancer, mannosidase alpha-like 3
• ER degradation-enhancing alpha-mannosidase-like 3
• ER degradation-enhancing -mannosidase-like protein 3

Background

Quality control in the endoplasmic reticulum (ER) ensures that only properly folded proteins are retained in the cell through recognition and degradation of misfolded or unassembled proteins. EDEM3 belongs to a group of proteins that accelerate degradation of misfolded glycoproteins in the ER (Hirao et al., 2006 [PubMed 16431915]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EDEM3 Antibody (NBP1-88342)(3)

Publications using NBP1-88342

• Abdollahi M, Kato M, Lanting L et al. miR-379 mediates insulin resistance and obesity through impaired angiogenesis and adipogenesis regulated by ER stress Molecular Therapy - Nucleic Acids 2022-12-13 [PMID: 36250205] (Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Mouse)
• Abdollahi M, Kato M, Lanting L et al. Role of miR-379 in high-fat diet-induced kidney injury and dysfunction American journal of physiology. Renal physiology 2022-10-13 [PMID: 36227097]
• Kato M, Abdollahi M, Tunduguru R, et al. miR-379 deletion ameliorates features of diabetic kidney disease by enhancing adaptive mitophagy via FIS1 Communications biology 2021-01-04 [PMID: 33398021] (ICC/IF, IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: EDEM3