EDEM3 Antibody

Images

 
Immunohistochemistry-Paraffin: EDEM3 Antibody [NBP1-88341] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EDEM3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FRSGAKPPLRARDFMATNPEHLEILKKMGVSLIHLKDGRVQLVQHAIQAASSIDAEDGLRFMQEMIELSSQQQKEQQLPPRAVQIVSHPFFGRVVLTAGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EDEM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
EDEM3 Protein (NBP1-88341PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EDEM3 Antibody

  • C1orf22
  • chromosome 1 open reading frame 22
  • ER degradation enhancer, mannosidase alpha-like 3
  • ER degradation-enhancing alpha-mannosidase-like 3
  • ER degradation-enhancing -mannosidase-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055741-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-82802
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81623
Species: Hu
Applications: IHC, IHC-P
NB100-519
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, KO
NBP1-86802
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45402
Species: Hu
Applications: WB, Flow, IHC
AF1543
Species: Hu
Applications: WB, IHC
NBP1-81884
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31293
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-46278
Species: Hu
Applications: WB, IHC, IF
NBP1-92252
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EDEM3 Antibody (NBP1-88341) (0)

There are no publications for EDEM3 Antibody (NBP1-88341).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDEM3 Antibody (NBP1-88341) (0)

There are no reviews for EDEM3 Antibody (NBP1-88341). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EDEM3 Antibody (NBP1-88341) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EDEM3 Products

Bioinformatics Tool for EDEM3 Antibody (NBP1-88341)

Discover related pathways, diseases and genes to EDEM3 Antibody (NBP1-88341). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDEM3 Antibody (NBP1-88341)

Discover more about diseases related to EDEM3 Antibody (NBP1-88341).
 

Pathways for EDEM3 Antibody (NBP1-88341)

View related products by pathway.

PTMs for EDEM3 Antibody (NBP1-88341)

Learn more about PTMs related to EDEM3 Antibody (NBP1-88341).
 

Research Areas for EDEM3 Antibody (NBP1-88341)

Find related products by research area.

Blogs on EDEM3

There are no specific blogs for EDEM3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EDEM3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EDEM3