EDAR Antibody


Western Blot: EDAR Antibody [NBP1-69709] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: EDAR Antibody [NBP1-69709] - This Anti-EDAR antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.
Western Blot: EDAR Antibody [NBP1-69709] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

EDAR Antibody Summary

Synthetic peptides corresponding to EDAR(ectodysplasin A receptor) The peptide sequence was selected from the middle region of EDAR. Peptide sequence PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against EDAR and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EDAR Antibody

  • Anhidrotic ectodysplasin receptor 1
  • DLED3
  • Ectodermal dysplasia receptor
  • ectodysplasin 1, anhidrotic receptor
  • ectodysplasin A receptor
  • Ectodysplasin-A receptor
  • ED1R
  • ED5
  • EDA1R
  • EDA3EDA-A1 receptor
  • EDA-A1R
  • EDAR
  • FLJ94390
  • HRM1
  • mouse, homolog of
  • tumor necrosis factor receptor superfamily member EDAR


EDAR is a member of the tumor necrosis factor receptor family. It is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in the gene encoding EDAR result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia.This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Block
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: WB, Block
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EDAR Antibody (NBP1-69709) (0)

There are no publications for EDAR Antibody (NBP1-69709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDAR Antibody (NBP1-69709) (0)

There are no reviews for EDAR Antibody (NBP1-69709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EDAR Antibody (NBP1-69709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EDAR Products

Bioinformatics Tool for EDAR Antibody (NBP1-69709)

Discover related pathways, diseases and genes to EDAR Antibody (NBP1-69709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDAR Antibody (NBP1-69709)

Discover more about diseases related to EDAR Antibody (NBP1-69709).

Pathways for EDAR Antibody (NBP1-69709)

View related products by pathway.

PTMs for EDAR Antibody (NBP1-69709)

Learn more about PTMs related to EDAR Antibody (NBP1-69709).

Research Areas for EDAR Antibody (NBP1-69709)

Find related products by research area.

Blogs on EDAR

There are no specific blogs for EDAR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EDAR Antibody and receive a gift card or discount.


Gene Symbol EDAR