We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ECT2 Antibody

Images

 
Western Blot: ECT2 Antibody [NBP1-58303] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related ECT2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-58303
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ECT2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ECT2(epithelial cell transforming sequence 2 oncogene) The peptide sequence was selected from the middle region of ECT2. Peptide sequence KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ECT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ECT2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ECT2 Antibody

  • ARHGEF31
  • epithelial cell transforming sequence 2 oncogene
  • Epithelial cell-transforming sequence 2 oncogene
  • FLJ10461
  • MGC138291
  • protein ECT2

Background

ECT2 is a transforming protein that is related to Rho-specific exchange factors and yeast cell cycle regulators. The expression of ECT2 is elevated with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis showed that expression is at a high level in cells undergoing mitosis in regenerating liver. Thus, this protein is expressed in a cell cycle-dependent manner during liver regeneration, and is thought to have an important role in the regulation of cytokinesis.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The protein encoded by this gene is a transforming protein that is related to Rho-specific exchange factors and yeast cell cycle regulators. The expression of this gene is elevated with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis showed that expression is at a high level in cells undergoing mitosis in regenerating liver. Thus, this protein is expressed in a cell cycle-dependent manner during liver regeneration, and is thought to have an important role in the regulation of cytokinesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NB110-68800
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF6260
Species: Hu
Applications: WB
H00029127-M01
Species: Ch, Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NBP2-56923
Species: Hu
Applications: ICC/IF
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00008502-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-87154
Species: Hu
Applications: COMET, ICC/IF, IHC,  IHC-P, KD, mIF, WB
NBP2-38487
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49172
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-58303
Species: Hu
Applications: WB

Publications for ECT2 Antibody (NBP1-58303) (0)

There are no publications for ECT2 Antibody (NBP1-58303).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECT2 Antibody (NBP1-58303) (0)

There are no reviews for ECT2 Antibody (NBP1-58303). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ECT2 Antibody (NBP1-58303) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ECT2 Products

Research Areas for ECT2 Antibody (NBP1-58303)

Find related products by research area.

Blogs on ECT2

There are no specific blogs for ECT2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECT2
Uniprot