![Western Blot: ECM2 Antibody [NBP2-82972] - WB Suggested Anti-ECM2 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell](http://images.novusbio.com/fullsize/ECM2-Antibody-Western-Blot-NBP2-82972-img0001.jpg "Western Blot: ECM2 Antibody [NBP2-82972] - WB Suggested Anti-ECM2 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit ECM2 Antibody - BSA Free (NBP2-82972) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ECM2. Peptide sequence: FGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ECM2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Simple_Western_18969.jpg)
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Western_Blot_19006.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images/af1060_mouse-decorin-affinity-purified-polyclonal-ab-8120255552891.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ECM2 |
![Western Blot SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Western_Blot_20730.jpg)
![Immunohistochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunohistochemistry_10419.jpg)
![Immunocytochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunocytochemistry__Immunofluorescence_23321.jpg)
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Immunohistochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images/mab2006_human-runx2-cbfa1-mab-clone-232902-812025555286.jpg)
![Western Blot RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images/mab2006_human-runx2-cbfa1-mab-clone-232902-western-blot-121220258505315.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/IRF1_AF4715_Western_Blot_5529.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4715_mouse-irf1-affinity-purified-polyclonal-ab-western-blot-16122024101037..png)
![Western Blot MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images2/MuRF1_AF5366_Western_Blot_5701.jpg)
![Simple Western MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images2/MuRF1_AF5366_Simple_Western_17120.jpg)
![Western Blot MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images/af5366_human-mouse-rat-murf1-trim63-affinity-purified-polyclonal-ab-41202412402520.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
