ECHS1 Antibody - BSA Free

Western Blot: ECHS1 Antibody [NBP1-87079] - Analysis using Anti-ECHS1 antibody NBP1-87079 (A) shows similar pattern to independent antibody NBP1-87078 (B).

Immunocytochemistry/Immunofluorescence: ECHS1 Antibody [NBP1-87079] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87079] - Staining of human kidney.

Western Blot: ECHS1 Antibody [NBP1-87079] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87079] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87079] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87079] - Staining in human liver and skeletal muscle tissues using anti-ECHS1 antibody. Corresponding ECHS1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87079] - Staining of human cerebral cortex, kidney, liver and testis using Anti-ECHS1 antibody NBP1-87079 (A) shows similar protein distribution across tissues to independent antibody NBP1-87078 (B).

Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87079] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87079] - Staining of human testis.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.

Staining of human gastrointestinal, heart muscle, kidney and liver using Anti-ECHS1 antibody NBP1-87079 (A) shows similar protein distribution across tissues to independent antibody NBP1-87078 (B).

Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Analysis using Anti-ECHS1 antibody NBP1-87079 (A) shows similar pattern to independent antibody NBP1-87078 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ECHS1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ECHS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ECHS1 Protein (NBP1-87079PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ECHS1 Antibody - BSA Free

• EC 4.2.1
• enoyl CoA hydratase, short chain, 1, mitochondrial
• enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
• Enoyl-CoA hydratase 1
• enoyl-CoA hydratase, mitochondrial
• SCEHEC 4.2.1.17
• Short-chain enoyl-CoA hydratase

Background

ECHS1 is encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ECHS1