ECHS1 Antibody

Images

 
Western Blot: ECHS1 Antibody [NBP1-87078] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ECHS1 Antibody [NBP1-87078] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ECHS1 Antibody [NBP1-87078] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ECHS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ECHS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ECHS1 Protein (NBP1-87078PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ECHS1 Antibody

  • EC 4.2.1
  • enoyl CoA hydratase, short chain, 1, mitochondrial
  • enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
  • Enoyl-CoA hydratase 1
  • enoyl-CoA hydratase, mitochondrial
  • SCEHEC 4.2.1.17
  • Short-chain enoyl-CoA hydratase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03825
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-88364
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-16429
Species: Hu
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-16700
Species: Hu, Mu
Applications: WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59576
Species: Hu
Applications: WB, IHC
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-92431
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83215
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-55460
Species: Hu
Applications: WB, ICC/IF
NBP1-87078
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ECHS1 Antibody (NBP1-87078) (0)

There are no publications for ECHS1 Antibody (NBP1-87078).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECHS1 Antibody (NBP1-87078) (0)

There are no reviews for ECHS1 Antibody (NBP1-87078). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ECHS1 Antibody (NBP1-87078) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ECHS1 Products

Bioinformatics Tool for ECHS1 Antibody (NBP1-87078)

Discover related pathways, diseases and genes to ECHS1 Antibody (NBP1-87078). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECHS1 Antibody (NBP1-87078)

Discover more about diseases related to ECHS1 Antibody (NBP1-87078).
 

Pathways for ECHS1 Antibody (NBP1-87078)

View related products by pathway.

PTMs for ECHS1 Antibody (NBP1-87078)

Learn more about PTMs related to ECHS1 Antibody (NBP1-87078).
 

Research Areas for ECHS1 Antibody (NBP1-87078)

Find related products by research area.

Blogs on ECHS1

There are no specific blogs for ECHS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECHS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECHS1