![Western Blot: EBF-3 Antibody (1G3) [H00253738-M06] - Analysis of EBF3 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/fullsize/EBF-3-Antibody-1G3-Western-Blot-H00253738-M06-img0003.jpg "Western Blot: EBF-3 Antibody (1G3) [H00253738-M06] - Analysis of EBF3 expression in PC-12 (Cat # L012V1).")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 1G3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse EBF-3 Antibody (1G3) - Azide and BSA Free (H00253738-M06) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | EBF3 (NP_001005463, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTS |
| Specificity | EBF3 - early B-cell factor 3 (1G3) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | EBF3 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EBF3 |
| Entrez |
|
| Uniprot |
|
![Western Blot: EBF-3 Antibody (1G3) [H00253738-M06] - Analysis of EBF3 expression in IMR-32 (Cat # L008V1).](http://images.novusbio.com/fullsize/EBF-3-Antibody-1G3-Western-Blot-H00253738-M06-img0004.jpg "Western Blot: EBF-3 Antibody (1G3) [H00253738-M06] - Analysis of EBF3 expression in IMR-32 (Cat # L008V1).")
![Western Blot EBF-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EBF-1_AF5165_Western_Blot_5645.jpg)
![Western Blot EBF-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af5165_human-mouse-ebf-1-affinity-purified-polyclonal-ab-41202412403559.jpg)
![Western Blot EBF-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af5165_human-mouse-ebf-1-affinity-purified-polyclonal-ab-41202412403592.jpg)
![Western Blot EBF-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EBF-2_AF7006_Western_Blot_11279.jpg)
![Immunohistochemistry EBF-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EBF-2_AF7006_Immunohistochemistry_11307.jpg)
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")