EBF-1 Antibody - Azide and BSA Free

Western Blot: EBF-1 Antibody [H00001879-D01P] - Analysis of EBF1 expression in transfected 293T cell line by EBF1 polyclonal antibody.Lane 1: EBF1 transfected lysate(61.10 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EBF-1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: EBF1 (AAH41178.1, 1 a.a. - 560 a.a.) full-length human protein. MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQLPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTNYNSVTTSMNGYGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
• Specificity: EBF1 - early B-cell factor 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EBF1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP)
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. ChIP usage reported in scientific literature (PMID: 23074194).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EBF-1 Antibody - Azide and BSA Free

• COE1
• Collier, Olf and EBF transcription factor 1
• early B-cell factor 1
• Early B-cell factor
• EBF1
• EBF-1
• EBFFLJ41763
• O/E-1
• OE-1
• OLF1
• OLF1FLJ39389
• olfactory neuronal transcription factor 1
• transcription factor COE1

Background

Transcriptional activator which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3' (Bysimilarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EBF-1 Antibody (H00001879-D01P)(2)

Publications using H00001879-D01P

• Qi YY, Zhou XJ, Nath SK et al. A rare variant (rs933717) at FBXO31-MAP1LC3B in Chinese is associated with systemic lupus erythematosus. Arthritis & rheumatology (Hoboken, N.J.). 2017-10-17 [PMID: 29044928] (WB, Human)
• Lee ST, Xiao Y, Muench MO et al. A global DNA methylation and gene expression analysis of early human B-cell development reveals a demethylation signature and transcription factor network. Nucleic Acids Res. 2012-12-01 [PMID: 23074194] (Chemotaxis, Human)

Bioinformatics

• Gene Symbol: EBF1
• Entrez:
  • 1879(Human)
• Uniprot:
  • AAH41178.1(Human)