EBAG9/RCAS1 Antibody

Immunohistochemistry-Paraffin: EBAG9/RCAS1 Antibody [NBP1-84923] - Staining of human lymph node.

Immunohistochemistry-Paraffin: EBAG9/RCAS1 Antibody [NBP1-84923] - Staining of human cerebral cortex, colon, liver and lymph node using Anti-EBAG9 antibody NBP1-84923 (A) shows similar protein distribution across tissues to independent antibody NBP1-84922 (B).

Immunohistochemistry-Paraffin: EBAG9/RCAS1 Antibody [NBP1-84923] - Staining of human liver.

Immunohistochemistry-Paraffin: EBAG9/RCAS1 Antibody [NBP1-84923] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: EBAG9/RCAS1 Antibody [NBP1-84923] - Staining of human colon.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

EBAG9/RCAS1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
• Predicted Species: Mouse (99%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EBAG9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EBAG9/RCAS1 Protein (NBP1-84923PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EBAG9/RCAS1 Antibody

• Cancer-associated surface antigen RCAS1
• EB9cancer associated surface antigen
• estrogen receptor binding site associated, antigen, 9
• Estrogen receptor-binding fragment-associated gene 9 protein
• RCAS1PDAF
• receptor-binding cancer antigen expressed on SiSo cells

Background

EBAG9 was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor which binds to the estrogen-responsive element (ERE) found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Two transcript variants differing in the 5' UTR, but encoding the same protein, have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EBAG9