EAR2/NR2F6 Antibody

Product Discontinued

EAR2/NR2F6 Antibody Summary

• Immunogen: Synthetic peptides corresponding to NR2F6(nuclear receptor subfamily 2, group F, member 6) The peptide sequence was selected from the N terminal of NR2F6. Peptide sequence AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV.
• Predicted Species: Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Guinea Pig (93%), Canine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NR2F6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against NR2F6 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EAR2/NR2F6 Antibody

• EAR2
• EAR-2ERBA-related gene-2
• EAR2nuclear receptor subfamily 2 group F member 6
• ERBAL2
• ERBAL2v-erb-a avian erythroblastic leukemia viral oncogene homolog-like 2
• NR2F6
• nuclear receptor subfamily 2, group F, member 6
• V-erbA-related protein 2

Background

Orphan nuclear receptor EAR-2 (NR2F6, V-erbA related protein EAR-2 ) is predicted to be a protein similar in primary structure to receptors for steroid hormones or thyroid hormone (T3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NR2F6
• Uniprot:
  • P10588(Human)