EAR2/NR2F6 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to NR2F6(nuclear receptor subfamily 2, group F, member 6) The peptide sequence was selected from the N terminal of NR2F6.
Peptide sequence AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV. |
| Predicted Species |
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Guinea Pig (93%), Canine (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NR2F6 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Western Blot 1:100-1:2000
|
| Application Notes |
This is a rabbit polyclonal antibody against NR2F6 and was validated on Western blot. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for EAR2/NR2F6 Antibody
Background
Orphan nuclear receptor EAR-2 (NR2F6, V-erbA related protein EAR-2 ) is predicted to be a protein similar in primary structure to receptors for steroid hormones or thyroid hormone (T3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Po, Bv, Ca, Gp
Applications: WB, IHC
Publications for EAR2/NR2F6 Antibody (NBP1-52818) (0)
There are no publications for EAR2/NR2F6 Antibody (NBP1-52818).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EAR2/NR2F6 Antibody (NBP1-52818) (0)
There are no reviews for EAR2/NR2F6 Antibody (NBP1-52818).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EAR2/NR2F6 Antibody (NBP1-52818) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EAR2/NR2F6 Products
Blogs on EAR2/NR2F6