E74 like factor 1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

E74 like factor 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ELF1.
  
  

  Source: E. coli

  Amino Acid Sequence: PSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNSKAAKPKDPVEVAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDETLNSSVQSIRTIQAPTQVPVVVSPRNQQL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ELF1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90352.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for E74 like factor 1 Recombinant Protein Antigen

• E74-like factor 1 (ets domain transcription factor)
• E74-like factor 1
• ETS-related transcription factor Elf-1

Background

E74-like factor 1 (ELF1) is a member of the ETS (e26 transformation specific sequence) family of proteins, contains an ETS-domain, and shares sequence identity with the Drosophila ecdysone inducible E74 transcription factor. ETS was originally identified in the E26 retroviral isolate that led to the discovery of c-ets-1 (cellular ets-1), a cellular oncogenic transcription factor capable of transforming cells. Like ETS, ELF-1 functions as a transcription factor and has been shown to bind promoter and enhancer elements in a number of immunity responsive genes. ELF-1 is highly expressed in B-cells and appears to play an integral role in B-cell gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ELF1