E2F8 Antibody


Immunocytochemistry/ Immunofluorescence: E2F8 Antibody [NBP2-57373] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

E2F8 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSV
Specificity of human E2F8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
E2F8 Recombinant Protein Antigen (NBP2-57373PEP)

Reactivity Notes

Mouse 80%, Rat 80%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for E2F8 Antibody

  • E2F family member 8
  • E2F transcription factor 8
  • E2F-8
  • FLJ23311
  • transcription factor E2F8


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for E2F8 Antibody (NBP2-57373) (0)

There are no publications for E2F8 Antibody (NBP2-57373).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E2F8 Antibody (NBP2-57373) (0)

There are no reviews for E2F8 Antibody (NBP2-57373). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for E2F8 Antibody (NBP2-57373) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional E2F8 Products

Bioinformatics Tool for E2F8 Antibody (NBP2-57373)

Discover related pathways, diseases and genes to E2F8 Antibody (NBP2-57373). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E2F8 Antibody (NBP2-57373)

Discover more about diseases related to E2F8 Antibody (NBP2-57373).

Pathways for E2F8 Antibody (NBP2-57373)

View related products by pathway.

Research Areas for E2F8 Antibody (NBP2-57373)

Find related products by research area.

Blogs on E2F8

There are no specific blogs for E2F8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our E2F8 Antibody and receive a gift card or discount.


Gene Symbol E2F8