E2F8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: E2F8 Antibody [NBP2-57373] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

E2F8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: E2F8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  E2F8 Recombinant Protein Antigen (NBP2-57373PEP)

Reactivity Notes

Mouse 80%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for E2F8 Antibody - BSA Free

• E2F family member 8
• E2F transcription factor 8
• E2F-8
• FLJ23311
• transcription factor E2F8

Background

E2F8 is a gene that codes for a protein that is 867 amino acids long, weighs approximately 94 kDa, that is an atypical E2F transcription factor that helps facilitate with various processes including angiogenesis and the polyploidization of specialized cells, especially those in the placenta and liver. Current studies are being done on diseases and disorders related to this gene including hepatocellular carcinoma. E2F8 has also been shown to have interactions with E2F7, EWSR1, and LZTR1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: E2F8