Recombinant Human Dystrobrevin beta Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Dystrobrevin beta Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-560 of Human DTNB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEHSSWKSPAKKLSHAISKSLGCVPTREPPHPVFPEQPEKPLDLAHIVPPRPLTNMNDTMVSHMSSGVPTPTKSVLDSPSRLDEEHRLIARYAARLAAEAGNVTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHCPQDSLSGVGGDVQEAFAQAEEGAEEEEEKMQNGKDRG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DTNB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
87.23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dystrobrevin beta Protein

  • beta-dystrobrevin
  • DTN-B
  • dystrobrevin beta
  • dystrobrevin, beta
  • MGC17163
  • MGC57126

Background

DTNB( AAH16655, 1 a.a. - 561 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31329
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-24940
Species: Hu, Ye
Applications: WB
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89772
Species: Hu
Applications: IHC, IHC-P
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for Dystrobrevin beta Recombinant Protein (H00001838-P01) (0)

There are no publications for Dystrobrevin beta Recombinant Protein (H00001838-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dystrobrevin beta Recombinant Protein (H00001838-P01) (0)

There are no reviews for Dystrobrevin beta Recombinant Protein (H00001838-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dystrobrevin beta Recombinant Protein (H00001838-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dystrobrevin beta Products

Bioinformatics Tool for Dystrobrevin beta Recombinant Protein (H00001838-P01)

Discover related pathways, diseases and genes to Dystrobrevin beta Recombinant Protein (H00001838-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dystrobrevin beta Recombinant Protein (H00001838-P01)

Discover more about diseases related to Dystrobrevin beta Recombinant Protein (H00001838-P01).
 

Pathways for Dystrobrevin beta Recombinant Protein (H00001838-P01)

View related products by pathway.

PTMs for Dystrobrevin beta Recombinant Protein (H00001838-P01)

Learn more about PTMs related to Dystrobrevin beta Recombinant Protein (H00001838-P01).

Blogs on Dystrobrevin beta

There are no specific blogs for Dystrobrevin beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FANCD2 Antibody
NB100-182
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dystrobrevin beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DTNB