We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Dystrobrevin beta Recombinant Protein Antigen

Images

 
There are currently no images for Dystrobrevin beta Protein (NBP2-38915PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dystrobrevin beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DTNB.

Source: E. coli

Amino Acid Sequence: MIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DTNB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38915.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dystrobrevin beta Recombinant Protein Antigen

  • beta-dystrobrevin
  • DTN-B
  • dystrobrevin beta
  • dystrobrevin, beta
  • MGC17163
  • MGC57126

Background

Dystrobrevin beta encodes dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-32740
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NBP1-05950
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-89772
Species: Hu
Applications: IHC,  IHC-P
AF9024
Species: Mu, Rt
Applications: IHC, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
MAB7428
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, RNAi, Simple Western, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-86919
Species: Hu
Applications: IHC,  IHC-P, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB

Publications for Dystrobrevin beta Protein (NBP2-38915PEP) (0)

There are no publications for Dystrobrevin beta Protein (NBP2-38915PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dystrobrevin beta Protein (NBP2-38915PEP) (0)

There are no reviews for Dystrobrevin beta Protein (NBP2-38915PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dystrobrevin beta Protein (NBP2-38915PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dystrobrevin beta Products

Blogs on Dystrobrevin beta

There are no specific blogs for Dystrobrevin beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dystrobrevin beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DTNB