Myoferlin Antibody

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining in human urinary bladder and skeletal muscle tissues using NBP1-84694 antibody. Corresponding MYOF RNA-seq data are presented for the same tissues.

Western Blot: Myoferlin Antibody [NBP1-84694] - Analysis in human cell lines A-431 and HEK293 using Anti-MYOF antibody. Corresponding MYOF RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Myoferlin Antibody [NBP1-84694] - Staining of human cell line U-251 MG shows localization to plasma membrane & vesicles. Antibody staining is shown in green.

Western Blot: Myoferlin Antibody [NBP1-84694] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human prostate shows moderate to strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human urinary bladder shows strong membranous positivity in urothelial cells.

Simple Western: Myoferlin Antibody [NBP1-84694] - Lane view shows a specific band for Myoferlin using 200 ug/mL of RT4 cell lysate and 4 ug/mL antibody dilution. Electropherogram image of corresponding Simple Western lane view at WES molecular weight of 222 kDa. Image from an internal validation.

• Reactivity: Hu, Mu
• Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Myoferlin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYOF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western reported by internal validaton.
• Control Peptide:

  Myoferlin Protein (NBP1-84694PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%). Reactivity reported in scientific literature (PMID: 24586247)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Myoferlin Antibody

• fer-1 (C.elegans)-like 3 (myoferlin)
• FER1L3
• fer-1-like 3, myoferlin (C. elegans)
• fer-1-like 3, myoferlin
• Fer-1-like protein 3
• FLJ36571
• FLJ90777
• KIAA1207
• myoferlin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Myoferlin Antibody (NBP1-84694)(2)

Publications using NBP1-84694

• Volakis LI, Li R, Ackerman WE IV et al. Loss of Myoferlin Redirects Breast Cancer Cell Motility towards Collective Migration. PLoS One 2014 [PMID: 24586247]
• Lindgren D, Bostrom AK, Nilsson K et al. Isolation and characterization of progenitor-like cells from human renal proximal tubules. Am J Pathol 2011 Feb [PMID: 21281815]

Bioinformatics

• Gene Symbol: MYOF