Myoferlin Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Myoferlin Antibody - BSA Free (NBP1-84694) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-Myoferlin Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MYOF |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Simple Western 1:20
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and NIH-3T3, separated by Size, antibody dilution of 1:20, apparent MW was 220 kDa |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%).
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Myoferlin Antibody - BSA Free
Background
Myoferlin belongs to the ferlin family and contains five C2 domains. It is a calcium/phospholipid binding protein that plays a role in the plasmalemma repair mechanism of endothelial cells that permits rapid resealing of membranes disrupted by mechanical stress. It is also involved in endocytic recycling and implicated in VEGF signal transduction by regulating the levels of the receptor KDR. Myoferlin is expressed in myoblast and endothelial cells (at protein level), highly expressed in cardiac and skeletal muscles, also present in lung and at very low levels in kidney, placenta and brain. There are eight named isoforms.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
Species: Hu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Fi, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC
Publications for Myoferlin Antibody (NBP1-84694)(3)
Showing Publications 1 -
3 of 3.
Reviews for Myoferlin Antibody (NBP1-84694) (0)
There are no reviews for Myoferlin Antibody (NBP1-84694).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Myoferlin Antibody (NBP1-84694) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Myoferlin Products
Research Areas for Myoferlin Antibody (NBP1-84694)
Find related products by research area.
|
Blogs on Myoferlin