Myoferlin Antibody

Images

 
Orthogonal Strategies: Western Blot: Myoferlin Antibody [NBP1-84694] - Analysis in human cell lines A-431 and HEK293 using Anti-MYOF antibody. Corresponding MYOF RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: Myoferlin Antibody [NBP1-84694] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & vesicles. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining in human cervix, uterine and testis tissues using anti-MYOF antibody. Corresponding MYOF RNA-seq data are presented ...read more
Western Blot: Myoferlin Antibody [NBP1-84694] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human cervix, uterine shows high expression.
Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human testis shows low expression as expected.
Simple Western: Myoferlin Antibody [NBP1-84694] - Lane view shows a specific band for Myoferlin using 200 ug/ml of RT4 cell lysate and 4 ug/ml antibody dilution. Electropherogram image of corresponding Simple Western ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Myoferlin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV
Specificity
Specificity of human, mouse Myoferlin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYOF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western 4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western reported by internal validaton.
Control
Myoferlin Knockout HeLa Cell Lysate
Control Peptide
Publications
Read Publications using NBP1-84694.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%). Reactivity reported in scientific literature (PMID: 24586247)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myoferlin Antibody

  • fer-1 (C.elegans)-like 3 (myoferlin)
  • FER1L3
  • fer-1-like 3, myoferlin (C. elegans)
  • fer-1-like 3, myoferlin
  • Fer-1-like protein 3
  • FLJ36571
  • FLJ90777
  • KIAA1207
  • myoferlin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66814
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-66813
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31896
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33283
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34061
Species: Hu
Applications: IHC, IHC-P
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-68927
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19320
Species: Mu, Rt, Fi, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Myoferlin Antibody (NBP1-84694)(2)

Reviews for Myoferlin Antibody (NBP1-84694) (0)

There are no reviews for Myoferlin Antibody (NBP1-84694). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myoferlin Antibody (NBP1-84694) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Myoferlin Products

Bioinformatics Tool for Myoferlin Antibody (NBP1-84694)

Discover related pathways, diseases and genes to Myoferlin Antibody (NBP1-84694). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myoferlin Antibody (NBP1-84694)

Discover more about diseases related to Myoferlin Antibody (NBP1-84694).
 

Pathways for Myoferlin Antibody (NBP1-84694)

View related products by pathway.

PTMs for Myoferlin Antibody (NBP1-84694)

Learn more about PTMs related to Myoferlin Antibody (NBP1-84694).

Blogs on Myoferlin

There are no specific blogs for Myoferlin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myoferlin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYOF