Myoferlin Antibody

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining in human urinary bladder and skeletal muscle tissues using NBP1-84694 antibody. Corresponding MYOF RNA-seq data are presented for the same tissues.

Western Blot: Myoferlin Antibody [NBP1-84694] - Analysis in human cell lines A-431 and HEK293 using Anti-MYOF antibody. Corresponding MYOF RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Myoferlin Antibody [NBP1-84694] - Staining of human cell line U-251 MG shows localization to plasma membrane & vesicles. Antibody staining is shown in green.

Western Blot: Myoferlin Antibody [NBP1-84694] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human prostate shows moderate to strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human urinary bladder shows strong membranous positivity in urothelial cells.

Simple Western: Myoferlin Antibody [NBP1-84694] - Lane view shows a specific band for Myoferlin using 200 ug/mL of RT4 cell lysate and 4 ug/mL antibody dilution. Electropherogram image of corresponding Simple Western lane view at WES molecular weight of 222 kDa. Image from an internal validation.

• Reactivity: Hu, Mu
• Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Myoferlin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYOF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western reported by internal validaton.
• Control Peptide:

  Myoferlin Protein (NBP1-84694PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%). Reactivity reported in scientific literature (PMID: 24586247)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Myoferlin Antibody

• fer-1 (C.elegans)-like 3 (myoferlin)
• FER1L3
• fer-1-like 3, myoferlin (C. elegans)
• fer-1-like 3, myoferlin
• Fer-1-like protein 3
• FLJ36571
• FLJ90777
• KIAA1207
• myoferlin

Background

Myoferlin belongs to the ferlin family and contains five C2 domains. It is a calcium/phospholipid binding protein that plays a role in the plasmalemma repair mechanism of endothelial cells that permits rapid resealing of membranes disrupted by mechanical stress. It is also involved in endocytic recycling and implicated in VEGF signal transduction by regulating the levels of the receptor KDR. Myoferlin is expressed in myoblast and endothelial cells (at protein level), highly expressed in cardiac and skeletal muscles, also present in lung and at very low levels in kidney, placenta and brain. There are eight named isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Myoferlin Antibody (NBP1-84694)(2)

Publications using NBP1-84694

• Volakis LI, Li R, Ackerman WE IV et al. Loss of Myoferlin Redirects Breast Cancer Cell Motility towards Collective Migration. PLoS One 2014-01-01 [PMID: 24586247]
• Lindgren D, Bostrom AK, Nilsson K et al. Isolation and characterization of progenitor-like cells from human renal proximal tubules. Am J Pathol 2011-02-01 [PMID: 21281815]

Bioinformatics

• Gene Symbol: MYOF