Dyrk1B Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DYRK1B |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200-1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Dyrk1B Antibody
Background
DYRK1B is a member of the DYRK family of protein kinases. DYRK1B contains a bipartite nuclear localization signal andis found mainly in muscle and testis. The protein is proposed to be involved in the regulation of nuclear functions.Three isoforms of DYRK1B have been identified differing in the presence of two alternatively spliced exons within thecatalytic domain. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Publications for Dyrk1B Antibody (NBP1-82643) (0)
There are no publications for Dyrk1B Antibody (NBP1-82643).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Dyrk1B Antibody (NBP1-82643) (0)
There are no reviews for Dyrk1B Antibody (NBP1-82643).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Dyrk1B Antibody (NBP1-82643) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Dyrk1B Products
Research Areas for Dyrk1B Antibody (NBP1-82643)
Find related products by research area.
|
Blogs on Dyrk1B